(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0085

BA000037.VV0085      Location/Qualifiers
FT   CDS_pept        complement(96618..96932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0085"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92848"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92848"
FT                   /db_xref="GOA:Q7MQC4"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQC4"
FT                   /protein_id="BAC92848.1"
FT                   /translation="MNNTEFHQLVDNELQLIEEAIDESGADIDYETTGNVMTLEFDDRS
FT                   QIIINRQEPMQEIWLASKSGGFHFQYKAGQWICSKTGVEFAHMVKQECEKHAGESIDWA
FT                   "
     atgaacaata ctgaatttca tcaactagtg gataacgagc tgcaactcat tgaagaagcg        60
     attgatgaat caggcgcaga catcgattac gagaccacgg gcaacgtgat gacgttagaa       120
     tttgatgacc gcagccaaat catcatcaat cgccaagagc cgatgcaaga aatttggtta       180
     gcctcgaaat ccggcggttt ccacttccaa tacaaagcgg gtcagtggat ttgctccaag       240
     actggcgttg agtttgcaca catggtcaaa caagagtgtg aaaaacacgc gggtgaatcg       300
     atcgattggg cttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page