(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0088

BA000037.VV0088      Location/Qualifiers
FT   CDS_pept        99310..100011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92852"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92852"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC0"
FT                   /protein_id="BAC92852.1"
FT                   /translation="MSYPEADALTAEVVAEYLQDHADFFVHRPELVDRLNFPHPEQGTV
FT                   SLVHIQLNRQRQRIEALEEEITTLMSLAANNDRTFYEFMDLQEQILRCRDFQQVIKAIE
FT                   QKAHELGLVAYVRLLNQCEAKHQLSMENYQRFATNHLNGKSAYLGRLRNADREALFGDL
FT                   PVPEMGSYVVLPLVKQHPLGLLAFSSADGGHFQPEMDTLFLRHLSLVVAHLAQTLAWQL
FT                   QHDDSVKHTTA"
     ttgtcttacc ctgaagccga tgctctgacc gccgaagtgg tggcggagta tcttcaagat        60
     catgccgatt tttttgttca tcgtccggag ttggtcgacc gcttgaactt tccgcacccg       120
     gaacaaggga cagtatcgct tgtccacatt caactgaacc gtcagcgtca gcgtattgaa       180
     gcgttggaag aagagatcac gactttgatg tctttggcag cgaacaacga tcgcaccttt       240
     tatgagttca tggacctgca agagcagatc ctgcgttgcc gcgattttca acaagtaatc       300
     aaagcgattg agcaaaaagc gcatgagctt ggtctggtgg cctatgtgcg tttgctgaac       360
     caatgtgaag caaagcatca actgagcatg gaaaattacc agcgttttgc caccaaccat       420
     ctcaatggta aatcggcgta tttgggccgt ctgcgcaacg ctgatcgcga agcgctgttt       480
     ggtgatttac ccgtgccaga aatgggctct tacgtggttt tgccattggt gaagcaacat       540
     ccccttggtt tgctggcgtt ttccagtgcc gacggtggtc atttccaacc ggagatggat       600
     accttgttct tacgtcatct ctcgttagtg gtggcccatt tagctcaaac ccttgcctgg       660
     caattgcagc atgacgacag cgtcaaacac accactgcct ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page