(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0101

BA000037.VV0101      Location/Qualifiers
FT   CDS_pept        112514..113023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0101"
FT                   /product="predicted protein-tyrosine phosphatase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92865"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92865"
FT                   /db_xref="GOA:Q7MQA7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA7"
FT                   /protein_id="BAC92865.1"
FT                   /translation="METSITNHPVWQLDLPSGALVLTPCPGTKGVDLRSSLQQLADIGV
FT                   QAVVTALGDAELASKEVAELGPLVVELGMRWYQIEIEDDCAPDETFAVHWQQASPELQA
FT                   ILRDGGKVALHCMGGSGRTGLFAAHLLLEQGWALDDIIREVQALRPGAFTREVQLSYIE
FT                   SVANAQ"
     atggaaacgt caatcaccaa ccaccctgtt tggcaattgg acctaccgtc tggcgcattg        60
     gtcttaacac cttgccctgg taccaaaggg gtcgatttac gttcgtcatt gcaacagttg       120
     gcggacatcg gtgtacaagc cgttgtgacg gcgctgggcg atgcggaact ggcgagtaaa       180
     gaggtcgcag agcttggccc gttggtcgtc gagctcggca tgcgttggta tcaaatcgaa       240
     atcgaagatg actgtgcgcc agatgagacc ttcgccgtgc attggcagca agccagccca       300
     gagctgcaag ccattctccg tgatggtggc aaagtggcgc tgcactgcat gggcggctcc       360
     ggtcgcaccg gattgttcgc cgcccatttg ctgttagagc aaggctgggc attggacgac       420
     attatccgtg aagtgcaagc gttgagaccc ggcgccttca cacgagaagt gcagttgagc       480
     tacatcgaat ctgtggcaaa cgcacagtga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page