(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0103

BA000037.VV0103      Location/Qualifiers
FT   CDS_pept        114408..115421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92867"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92867"
FT                   /db_xref="GOA:Q7MQA5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA5"
FT                   /protein_id="BAC92867.1"
FT                   /translation="MRERVQFFDLLRCVAAVAVIAIHVLAPYRHELGVIPFDQWVTAVG
FT                   INGISRWAVPVFILITGALMLSDTRPFDLPYYARRRLGKVLIPFLFWSLFYALLSGLSA
FT                   SGFDSSKVTEVLSNSPEHATYYHLGFFYYFIPLYFVIPMFQWLVRQQRQDILYLFTALW
FT                   LFTTVLYLAGIDGPWSYELWLYSGYLPLGYLLFSKVPNQRSVVVGSVLLGGMALAATVI
FT                   MVVSNSLAAGEYTVGRWLSYKTINVVLAASMVFVLCRSVGERLSAQWQKWVALISRHSL
FT                   GIYLLHPIFLWPMKELGWYQGHPAWVIPLWVVLSGAGALALSYLFSLSAKTRWLLP"
     atgcgcgaaa gagttcagtt ttttgatttg ctacgatgtg tcgcggcggt ggccgtgatc        60
     gccattcatg tgcttgcgcc ttatcgtcat gagttagggg tgattccttt tgatcaatgg       120
     gtgacggccg ttggcatcaa tggtatttct cgttgggcgg taccggtttt tattcttatc       180
     actggcgccc tgatgctcag tgacactcgg ccatttgatc tgccttatta tgctcgtcgt       240
     cgtttaggta aggtgctgat cccttttctc ttttggtcgt tgttctatgc gctcctctcc       300
     ggcttgagtg cgagcggttt tgatagcagc aaagtgacag aagtgctcag caacagccca       360
     gagcatgcca cctattacca tcttggtttc ttctattatt ttattccgct ctattttgtg       420
     attccgatgt tccagtggct tgttcgccag caacgtcagg acatcctcta tctctttacc       480
     gcgttatggt tgttcaccac tgtgttgtat ctggcgggca tcgatggccc ttggagctac       540
     gagctatggc tgtacagtgg ctaccttcct cttggctatc tgctctttag caaagtcccg       600
     aatcaacgct cagtggtcgt tgggtcggtg ctgctggggg gaatggcatt ggctgccacg       660
     gttatcatgg tggtgagtaa tagccttgct gcaggggaat acaccgtcgg gcgttggttg       720
     tcgtataaaa ccattaatgt ggtattggcc gcgtcgatgg tgtttgtgct gtgtcgctct       780
     gtgggcgagc ggttgtcggc tcaatggcaa aagtgggtgg cgttaatcag ccgccacagt       840
     ttaggcatct atttattgca tcctattttt ctatggccaa tgaaagagtt gggctggtat       900
     cagggtcatc ctgcgtgggt catcccgtta tgggtcgtgc tgagtggggc gggtgcctta       960
     gcgttgagtt atctattttc gctctccgct aagacacgtt ggttattgcc ttag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page