(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0106

BA000037.VV0106      Location/Qualifiers
FT   CDS_pept        116846..116980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92870"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92870"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA2"
FT                   /protein_id="BAC92870.1"
FT                   /translation="MSGVGGSYCSFGLIVVFFDGADLKFKKVNRGCMGDLSLDEKTMM"
     ttgtctggtg ttggtggttc ttactgctct tttggcttaa tagttgtgtt ttttgatggt        60
     gcggatttga aattcaagaa agtcaataga ggctgtatgg gggatttatc attggatgag       120
     aaaacaatga tgtga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page