(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0108

BA000037.VV0108      Location/Qualifiers
FT   CDS_pept        118080..118301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92872"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92872"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA0"
FT                   /protein_id="BAC92872.1"
FT                   /translation="MNDIHAHNLLHLLKEQPMDRAELLAHFGGDTRFHTCKLQGLDLDS
FT                   LLSFLLEREKISEQQGKFCVNLARICNH"
     atgaatgata tccatgctca caatcttctt catctcctta aagaacaacc gatggaccgt        60
     gcagaattgc ttgcgcattt cggtggcgat acccgttttc atacgtgcaa attacaaggg       120
     ctcgacttgg actcactgct gagctttttg ttggaacgag aaaaaatcag tgagcagcaa       180
     ggaaaattct gtgtgaatct ggcgcgaatc tgtaatcact aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page