(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0119

BA000037.VV0119      Location/Qualifiers
FT   CDS_pept        complement(125842..126252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0119"
FT                   /product="flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92883"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92883"
FT                   /db_xref="GOA:Q7MQ89"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ89"
FT                   /protein_id="BAC92883.1"
FT                   /translation="MYKRYIAQIIIAFSLLFSLPLHAEEEQTGPQLAYFTLEPDLTTNF
FT                   YTKGKKLGYIQVRIDIMVMSNADLALVEHHQPLIRDAVVELLGQQSEDTVKSLAGREDL
FT                   RKHLVEKLNEILLPETGKTVIADLLFTKYLYQ"
     atgtacaaac gttatatagc ccaaataatt atcgccttca gcttgctctt ttctttacct        60
     ttgcatgcgg aagaagaaca gactggccct caactggcgt atttcaccct tgagccagac       120
     ctcaccacca acttttacac caaaggcaag aaactgggtt acatccaagt gcgcatcgac       180
     atcatggtca tgagcaatgc ggatttggcg ttggtcgaac accatcagcc gttgatcaga       240
     gacgctgtgg ttgagttgct gggtcagcaa agtgaagaca cggtgaagtc actggctgga       300
     cgtgaagatt tgcgtaagca tttggtcgaa aaactcaatg agatcttatt gccagaaacg       360
     ggcaaaaccg tcattgctga cctgctgttt accaaatacc tctatcagta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page