(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0125

BA000037.VV0125      Location/Qualifiers
FT   CDS_pept        133485..133604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92890"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ82"
FT                   /protein_id="BAC92890.1"
FT                   /translation="MRIGKAGSAENQLALIAVIKALAQASLLVDNGFRVAENG"
     gtgcgcatcg gtaaagcggg cagtgccgaa aatcaattgg cactgattgc ggtcataaaa        60
     gccttggcgc aagcgagtct gcttgtcgat aacggatttc gcgtggccga gaatggttga       120
//

If you have problems or comments...

PBIL Back to PBIL home page