(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0132

BA000037.VV0132      Location/Qualifiers
FT   CDS_pept        140561..142738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92896"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92896"
FT                   /db_xref="GOA:Q7MQ76"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ76"
FT                   /protein_id="BAC92896.1"
FT                   /translation="MLSFDNSQDLELTLDAMRSIGGQKDYLQQVLFPALLRGNWEELDK
FT                   MVVYQDERKTILFGEDAWMFAQSAYKGKNKSNIYFNIELEQGENVIVFRQNERHLVNQV
FT                   KCIAVANMWFSGQHIELGSLSSKIGLLRNYIVKLFKRGITSFEELNQEHLDILVEDGFF
FT                   DMSNSKVFTGLNYLPALKGLLPFTVNFNRLTHKMFNARPDDTEGTLVIPPRIYFAALTE
FT                   YSEGIAKAYGLRDEIEQAVEQMLFFYKYEEKRRLLDIRNGEIYKPIKGYEKNWERFTQA
FT                   LENEGVALVDKGKNPRWMEIFTSLKTRILLKDSQFHRFNVYIGDTFYDWGEFRRYLVSL
FT                   SAKASWLCLALSGMRIDELYRISPVYGAQEKKFDKNGDESGTGKEQIYFLTTRQSKITL
FT                   NSQTKNDVFVTTETGWKAFHVLNAIHTPYRNRFAGNDSHRMFANLQKVTYFKSVGKSAL
FT                   GKGVINNFNKNNVDFILTLDDMGYLQTSDPTQTSFKLGDKFHFTCHQLRRSLAYYLIGY
FT                   ELCSFPALKQQLSHLSMAMTRWYARNAFSFEKIYSEIQKERVTQQAKIFARIYQKMANR
FT                   ERIAGGKGQAISREGESYFEDGVNKRKLSKEYWIDLLTNGKAHLHAVAPGMYCTNTQCS
FT                   MRINIDLTECVDCEYDFIENAVYAEVSRMDAMRNIEFLKENNELNSSAATKYYMQVKAA
FT                   EEIMDDLVFEHDKYEFEEDVLSLVIPTKTVA"
     atgttgtctt ttgataattc gcaagattta gaattaactt tagatgccat gcgctccatt        60
     ggtggtcaaa aagattattt gcagcaagtg cttttccctg cgctactgcg aggtaattgg       120
     gaagagttgg acaaaatggt ggtttatcaa gatgagagaa agacaatctt gtttggggaa       180
     gatgcttgga tgtttgcaca gtctgcatat aaagggaaaa ataagtcaaa tatttatttt       240
     aatatagagt tagaacaagg cgagaacgtc attgtatttc gtcaaaacga acgtcattta       300
     gttaatcaag tgaagtgtat cgcagtagcg aatatgtggt tttcaggtca acatattgag       360
     ttaggttctc tctcaagcaa gataggtctt ttgcgaaatt atattgttaa actgtttaag       420
     cgtggtatta cttcttttga agagttaaac caagagcatc tagacatttt ggtcgaagat       480
     ggattttttg acatgtctaa ctccaaagtg tttactgggt taaactatct tcccgcttta       540
     aaaggtttac tgccatttac ggttaatttt aatcgcctaa cgcataaaat gtttaacgca       600
     agacctgatg acactgaagg aacattggtt attcctccgc ggatatattt tgcggcatta       660
     acggagtaca gcgaagggat tgcaaaagcc tatgggttaa gagatgaaat cgaacaagcg       720
     gttgagcaga tgcttttctt ttataaatat gaagaaaaaa ggagactttt agatataaga       780
     aatggagaga tatataaacc tataaagggt tatgagaaaa actgggagcg attcactcaa       840
     gcattagaaa acgagggagt tgctttagtc gataaaggca aaaatccgcg atggatggaa       900
     atattcacct ctcttaaaac tcgtattctc ttaaaagatt cacaatttca ccgttttaat       960
     gtgtatatcg gtgacacttt ctatgactgg ggtgaattta gacggtattt agttagcctc      1020
     agtgcaaagg cctcgtggtt atgtttggcg ttatcaggga tgaggataga tgagttgtat      1080
     cgaatcagtc ctgtatatgg ggcgcaggaa aagaagtttg ataaaaatgg cgatgaatca      1140
     ggtaccggca aggaacaaat ttactttcta acgacacgcc aatcaaaaat tacactcaat      1200
     agtcaaacca aaaatgatgt ttttgttacc actgaaactg gttggaaagc ctttcatgtg      1260
     ctaaatgcca ttcatacacc ttatcgaaac aggtttgcag ggaatgacag tcatagaatg      1320
     ttcgcaaact tgcaaaaggt tacttatttc aagtctgtag gaaagtctgc gttgggtaaa      1380
     ggtgtcataa ataattttaa caaaaacaac gttgatttta ttctgacatt agatgatatg      1440
     ggctatttac aaacatccga tccaacccag acatctttta aactgggtga caaatttcac      1500
     tttacgtgtc atcagttgcg acgttcactt gcatattacc taattggcta tgagttgtgt      1560
     tctttcccgg ctttgaagca acagttgtcg catttgtcga tggcgatgac acgctggtat      1620
     gctcgtaacg ccttttcatt tgaaaaaatt tacagcgaaa ttcaaaaaga gcgggtcacg      1680
     caacaggcta agatctttgc tcgtatatat caaaaaatgg caaaccgtga acgtattgca      1740
     gggggtaaag gtcaagcaat cagtcgtgaa ggtgaaagct attttgaaga tggagtaaat      1800
     aaacgtaagc tgtcaaagga gtactggata gatctgttga ccaacggtaa ggctcattta      1860
     catgctgtgg ctcctggtat gtattgtact aacactcaat gctcaatgcg tatcaatatt      1920
     gatttaactg agtgtgttga ctgtgagtat gactttattg aaaatgctgt ttacgctgaa      1980
     gtgtcccgta tggatgcgat gagaaatatt gagtttttaa aagaaaacaa tgagttaaat      2040
     tcaagcgctg caaccaaata ctatatgcaa gtaaaagctg ctgaagaaat aatggatgac      2100
     ttagtgttcg agcatgataa gtacgaattt gaagaagatg tgttgagttt ggttatacca      2160
     acaaaaacgg tggcgtaa                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page