(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0133

BA000037.VV0133      Location/Qualifiers
FT   CDS_pept        142742..143287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92897"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92897"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ75"
FT                   /protein_id="BAC92897.1"
FT                   /translation="MTDETGLSPTERQLRDALARLVAKRPIHRELKQKLKANKLKITVS
FT                   SVEKEAGLSNGVVKPERYPKLKEDILSAEAARKYGPVKDVSDEDIHRHPLYIKAKNDLD
FT                   KAKAEIKMIKAELTSKNSKLESYKERIKEQAVRMHQMNVAMWGQIPDEKKYVELMIDVQ
FT                   DMGMNSNVLDFKTREKLD"
     atgacagatg aaactggatt aagcccgacc gagaggcagt taagagacgc attagcacgc        60
     cttgttgcca aaaggccaat ccacagggag ctaaaacaga agcttaaagc caataagttg       120
     aaaattactg tttcaagtgt cgagaaggaa gctggattat cgaatggtgt agttaaacct       180
     gaacgttatc caaaactaaa ggaagacatt ctgagcgctg aagctgctcg taaatatggt       240
     cctgtaaaag atgtgtctga tgaagacatc cataggcatc ctttatacat taaagctaaa       300
     aatgatctag ataaagctaa ggctgaaata aaaatgatca aggcagaatt aacgtcgaaa       360
     aactcaaagt tagagagcta taaagagcgt ataaaagagc aagcagtaag aatgcatcaa       420
     atgaatgttg ccatgtgggg gcagattcct gatgaaaaaa aatatgttga gttgatgatt       480
     gatgttcaag atatgggaat gaacagtaac gttttagact ttaaaacgcg tgaaaaacta       540
     gattag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page