(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0139

BA000037.VV0139      Location/Qualifiers
FT   CDS_pept        149112..149792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92903"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92903"
FT                   /db_xref="GOA:Q7MQ69"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ69"
FT                   /protein_id="BAC92903.1"
FT                   /translation="MKLDKALSNISEKNNFIYLTLALIMLLIAAALVQLLQDNVIEYVI
FT                   QGIMVVIFIVCFVSLRFDRKWTHFLRGLAVVWIAAIAAKHLFHIKEMSILMLSLTFVFF
FT                   YGTFQSLVRKILFSGQIDTNKLIGSVALFLLLGLMWAVAYLLLLELDPFAFRGLEAIPW
FT                   EDNFSNSAYFSFVTLTTLGYGDISPVTPIAKTLVYLESVVGVFYMAVVVSSLVSSNLGR
FT                   NTPR"
     atgaagctcg ataaagcgtt gtcaaatatt agcgagaaga ataacttcat ctacttaacg        60
     ttagctttaa tcatgctgtt aattgccgcc gccctcgttc aactactaca agacaatgtg       120
     atcgaatacg tcatacaggg gattatggta gtgattttta ttgtttgctt tgtaagtttg       180
     cgctttgatc gaaagtggac gcatttttta agaggtttag ccgtggtttg gatagctgct       240
     attgccgcga aacacctctt tcatatcaaa gaaatgagca tattgatgct ttctctgact       300
     tttgtctttt tctatggcac tttccaatct ttagtaagaa aaatcttgtt ttcaggccaa       360
     atagacacca acaaacttat tggttctgta gccctattct tattgcttgg tttaatgtgg       420
     gcggtggctt accttttgtt acttgagcta gaccctttcg catttcgcgg gttagaagca       480
     attccttggg aagataattt ttctaatagc gcttatttta gcttcgtgac cttaaccact       540
     ctcggttatg gggatatcag tccagtgact ccaattgcga aaacgttagt ctatttagag       600
     tcggttgttg gtgtttttta tatggcagta gtggtgtcta gtttagtcag ttcgaattta       660
     ggtagaaaca cgcctagata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page