(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0143

BA000037.VV0143      Location/Qualifiers
FT   CDS_pept        153856..154398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92907"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ65"
FT                   /protein_id="BAC92907.1"
FT                   /translation="MTKKTAINEYIFTLFIEKGLDGLTVPALRDELLTITGEFEDITEA
FT                   RKFLYRQLLPLEKKGLLWTNGQGRTRTYHKSEQFKETVFKPKKRKQQKLKTVVKNSDEA
FT                   LTLDELTLERRKYEAELAIALAEIEEFQLLSERLPLQKSSLLKLSEETRERSVRYLAKI
FT                   NVLNHALKLSNCGEVKC"
     atgacgaaga aaacagcgat taatgaatat atttttacct tattcatcga gaaaggactt        60
     gatggattaa cggttcctgc cttaagggac gaactactaa cgattacggg agaatttgag       120
     gatataacgg aagcgcgtaa atttctttat cgtcagttat tgcctttaga aaagaaaggg       180
     ctactttgga ctaatggcca agggcggaca aggacatacc acaaatcaga gcagtttaaa       240
     gaaactgtat tcaaaccgaa aaagcgtaag caacaaaagc taaaaacagt cgtaaaaaat       300
     tcggatgaag cacttaccct tgatgagctg actttggaac gacgaaagta tgaagctgaa       360
     cttgcgatag ctttagctga gatcgaagaa tttcaactat tgtctgaaag gttaccttta       420
     cagaaatcat cattgttaaa actatccgaa gaaactagag aacgctctgt tagatatcta       480
     gccaaaataa atgttcttaa tcacgcccta aagcttagta attgtgggga agtaaaatgt       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page