(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0145

BA000037.VV0145      Location/Qualifiers
FT   CDS_pept        155818..156123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92909"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ63"
FT                   /protein_id="BAC92909.1"
FT                   /translation="MFYIGVSHYYATGEGLTMYVASGSEESIRAAIPEYFHLGLTILTP
FT                   SEWLKAAAGDCEDEYHQSEAEDLKAYLPLLWKQIEERALERGCHLDFFMKHHFNYA"
     atgttctaca tcggtgttag ccattattac gcaacaggtg aaggcctcac aatgtatgtt        60
     gctagcggta gcgaagaatc aatacgggca gccattccag aatattttca tcttgggctc       120
     actattttaa caccttcaga gtggctaaaa gctgctgcag gggactgtga ggatgaatat       180
     catcaatcgg aagcggaaga tctgaaagcc tatttaccac tcttatggaa gcaaattgag       240
     gaaagagcgt tagaaagagg atgtcatctg gactttttca tgaagcacca ttttaactat       300
     gcctaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page