(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0154

BA000037.VV0154      Location/Qualifiers
FT   CDS_pept        161096..161881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92918"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92918"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ54"
FT                   /protein_id="BAC92918.1"
FT                   /translation="MKLKTIILIIGFLSSPSIAFANENKVDVYDLVSTSSNVPTLDTVK
FT                   LITADGVLNKELKEFMLKKHNKQVLKDKKIAILATDGVEELEILVPLNYLREVGANVTI
FT                   VAPRKKIYPETLGLKIPENRRTHIMTVRLMENSGWLKIDKYIDEVSFDDFDGLVLPGGA
FT                   WNPDFLRTDVEAQNLVREIVNSNKPLATICHGPLVLINSGLVKDRKITGYWAIMKDLEN
FT                   AGAKVYDQPVVIDGNLISSRFPYDLPRLMNSFTEKLLNN"
     atgaaattaa aaactattat attaataatt ggttttttat catctcctag tattgctttt        60
     gctaatgaaa ataaagttga tgtatatgat ttagtttcaa ctagttctaa tgtcccgaca       120
     ttagatacag taaaacttat tacagctgat ggagtattaa acaaagagtt aaaagaattt       180
     atgcttaaaa agcataataa gcaagttttg aaagataaaa aaattgctat attagcaact       240
     gatggggttg aagagctaga aattttggtt ccattaaatt atttgagaga agttggagct       300
     aatgttacta ttgttgcacc aagaaaaaaa atttacccag aaacattggg actaaaaatt       360
     ccagaaaatc gtcgtacaca tattatgact gtaaggctaa tggaaaattc aggttggtta       420
     aaaatagaca aatatatcga tgaagtttct tttgatgatt ttgatggtct cgttttacct       480
     ggtggtgctt ggaatccaga cttcctaaga actgatgttg aagctcaaaa ccttgttaga       540
     gaaattgtaa attctaataa gcctcttgca actatatgtc atggtccatt agttttaatc       600
     aattcggggt tagttaaaga taggaaaata actggttact gggctatcat gaaagattta       660
     gaaaatgcag gagctaaagt atatgatcaa cctgttgtaa ttgacggaaa tttaatttct       720
     agtagattcc cttatgattt acctagattg atgaactcat tcacagaaaa attattaaat       780
     aattaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page