(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0164

BA000037.VV0164      Location/Qualifiers
FT   CDS_pept        170672..171766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92928"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92928"
FT                   /db_xref="GOA:Q7MQ44"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ44"
FT                   /protein_id="BAC92928.1"
FT                   /translation="MAITIHRAVVHELIKEKNEEPQPLHYRQSLLPVDNESVQNVIAGV
FT                   VNIYGRKNNSARYGVFRDDEASGSVPDSFYEYSELEDVSDEDFMVLSKSVMQELFREAT
FT                   GVAFATGGHILFSDYESDGVRFYLAAMIKQKSGFAFSDTLGVEDLEYIDLSKLHQAIKI
FT                   NFSKYNAYQNTDDIERQDSTYLSFVSPQTSQSAAGYFIQAMGCKAGAPSAKATQAAVDE
FT                   SVGFFESKEDLKAHAPNLKRALTVYLEQKAESNEPATLPDIEGIARRFFPTDDEEQADR
FT                   YADEFVTYLNREESGVPPEFPVNKTKLKTMTHLVYKGDDLHLEFDKEDIGGNPSARVYF
FT                   DGAKVIIKDLPQDLIDKLNQQING"
     atggcaatca ctattcatcg agctgttgtg catgaattga taaaagaaaa aaatgaagaa        60
     cctcaaccat tgcattaccg acaatccctt ctacctgtag ataatgagag tgtacagaat       120
     gtaattgctg gcgttgttaa tatttatgga agaaagaata acagtgccag atatggggtt       180
     tttcgggacg atgaggcctc tggaagtgta cccgattcat tttatgaata ctcagaacta       240
     gaagatgtta gtgatgaaga cttcatggtt ctatcaaagt cagtcatgca ggagttattt       300
     cgagaagcta ccggggttgc attcgctact ggtggacata tcttattttc ggattatgag       360
     agtgatggag ttagattcta tttagctgcg atgatcaagc aaaagtcagg attcgcattc       420
     tccgatacac tcggtgtgga agatcttgaa tacattgatt taagtaagct tcatcaagca       480
     attaaaatta atttttctaa atacaacgcc tatcaaaaca ctgatgatat tgaacgtcag       540
     gactctacgt atttaagttt tgttagtcca caaacaagtc agtcagcagc tggatatttc       600
     attcaggcga tgggatgtaa agctggtgca ccttcagcaa aagcaactca agcggctgtt       660
     gatgaaagtg ttggtttttt cgagtctaaa gaagatttga aagcgcatgc tccaaactta       720
     aaaagagcgt tgaccgttta tctggaacaa aaagctgaat ctaatgaacc agcaacttta       780
     cctgatatcg aaggaatcgc ccgacgtttt tttcctaccg atgatgaaga gcaggctgat       840
     agatatgctg atgagtttgt tacatattta aaccgcgaag aaagtggtgt tccacctgag       900
     ttccctgtta ataagacaaa actcaaaaca atgactcatt tagtctacaa aggtgacgat       960
     ttacacctag aatttgataa ggaagatata ggtggtaatc ccagtgcaag ggtttacttc      1020
     gatggagcta aagttataat caaggatctt ccacaagatc tgattgataa actaaatcag      1080
     caaattaatg ggtag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page