(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0171

BA000037.VV0171      Location/Qualifiers
FT   CDS_pept        complement(183051..183209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92935"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92935"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7F8"
FT                   /protein_id="BAC92935.1"
FT                   /translation="MGPKRYGRQANSVFVFTFSKKVKAKNLESCLCSLHIQCSYIESIK
FT                   TLWVLYG"
     gtgggtccaa aacgctatgg tcgccaagca aattctgttt ttgtcttcac tttttctaaa        60
     aaagtgaaag caaaaaatct ggaaagctgt ttatgttctc tacacattca atgttcttac       120
     atcgagtcca tcaaaaccct ttgggtgttg tatggttaa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page