(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0179

BA000037.VV0179      Location/Qualifiers
FT   CDS_pept        189822..191456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0179"
FT                   /product="putative ubiquinone biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92943"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92943"
FT                   /db_xref="GOA:Q7MQ31"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ31"
FT                   /protein_id="BAC92943.1"
FT                   /translation="MTPTELKRLYRIIKVQLEYGLDDLLPDHQLAKAPRWMRKSLFWLK
FT                   NQHPEKPLGDRLRLALQELGPVWIKFGQMLSTRRDLFPPHIADPLALLQDQVSPFDGAL
FT                   AKAQMEQALGGPLETWFSDFDLVPLASASIAQVHTAKLKTTNQEVVLKVIRPDIRPIID
FT                   ADLKLMRRMASIVAKAMPEARRLKPIEVVREYEKTLLDELDLRREAANAIQLRRNFTDS
FT                   EELYVPEVYPDFSNETVMVSERIYGIQVSDITGLKANGTNMKLLAERGVSVFFTQVFRD
FT                   SFFHADMHPGNVFVNPEHPENPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVA
FT                   ELHVDSGWVPADTNIDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPKALINAIKDRAPYWAE
FT                   KLPELPELLYDSLKQGKAMNQRMDQLYQGYRASKRQQATGKFLFGVGATLVVCSAILVD
FT                   HTYEQLSLATAIAGVTFWLFSWRAYRR"
     atgaccccga cagagctaaa gcgcctttat cgcatcatta aagttcagct tgaatatggt        60
     ttggatgacc tactgccaga ccatcaactt gccaaagcac cacgttggat gcgcaaaagc       120
     ttgttttggc ttaaaaatca gcatccagaa aaaccgttag gggatcgtct acgtcttgcc       180
     ctgcaagagc tagggcctgt ttggattaaa tttggccaga tgttgtctac tcgtcgcgat       240
     ctgtttcctc ctcacattgc agacccgctt gcactgctgc aagatcaagt ctcgcctttt       300
     gatggtgcat tggcgaaagc acaaatggag caagcgctcg gtgggccttt agaaacctgg       360
     tttagtgatt ttgacctagt tcctttagcg tcggcctcca ttgcgcaggt gcataccgcc       420
     aagctgaaaa cgactaacca agaagtggta ttaaaggtca ttcgcccaga tattcgtccc       480
     atcattgatg cagatctaaa actgatgcga cgtatggcga gtatagtcgc caaagcaatg       540
     cctgaagcac gtcgtcttaa accgatcgaa gtggttcgag agtatgagaa aaccttactg       600
     gatgagcttg atttgcgtcg cgaagcggcc aatgcgatac agctaagacg taattttacc       660
     gacagcgaag agttatacgt tcctgaagtt tatccggact ttagtaatga aactgtcatg       720
     gtttctgagc gaatatacgg catccaagtg tcggatatta caggcttgaa agcgaatggc       780
     accaacatga agttgttggc ggaaagaggg gtgagtgtat tctttaccca agtttttcgc       840
     gacagcttct tccatgcaga catgcatcca gggaacgtgt ttgttaaccc tgaacatccc       900
     gagaacccac aatggattgg tttggattgt ggcattgttg gcacattaaa tagcgaagat       960
     aaacgctatt tagcggaaaa ctttttggcg ttttttaatc gtgattatcg acgtgtggca      1020
     gagctgcatg tggactctgg ctgggtaccg gcagacacca atattgatga atttgaattt      1080
     gcgattcgta ttgtctgtga gccgattttt gccaaaccgt tgtgtgaaat ctcctttggt      1140
     catgtgttat tgaacctatt caataccgca aggcgattca atatggaagt tcagccgcaa      1200
     ctggtgttat tgcaaaaaac cttgctgtat gtggaaggat tagggcgcca gctttatcct      1260
     cagcttgatc tctgggaaac cgcaaaaccc ttccttgaag agtggatgat gaatcaagtt      1320
     ggtcctaaag cgttgatcaa tgcaataaaa gaccgcgcgc cttattgggc ggaaaaatta      1380
     cctgaactgc cggaattgct gtatgacagc ctcaaacagg gcaaagcgat gaaccagaga      1440
     atggatcagc tttaccaagg ctatcgagcc agcaagcgcc agcaggcaac aggaaagttt      1500
     ttatttggcg ttggggccac attagtcgta tgctcggcaa tattggtgga ccacacttat      1560
     gaacagcttt cactggcgac ggctattgca ggcgtcacat tttggctgtt cagttggcga      1620
     gcttatcgtc gttag                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page