(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0189

BA000037.VV0189      Location/Qualifiers
FT   CDS_pept        201669..202475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0189"
FT                   /product="methyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92954"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92954"
FT                   /db_xref="GOA:Q7MQ20"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ20"
FT                   /protein_id="BAC92954.1"
FT                   /translation="MQHSFGHSVAVRKATAWLSLFLFWPFFYEIGDYLPVGSPIWGDFL
FT                   VCFASLFEEVRMHTCPLCQHDQILHYFTDKRREYLQCARCELVFVHPEQRLDAKTEKSH
FT                   YDLHENNPLDLGYRRFLSRITDPLLERIAPQSNGLDFGCGPGPTLSLMLEEHGHVMSLY
FT                   DLYYHPDRSVLRREYDFMTATEVIEHLYEPNVVWQQWLNLVKPRGWIGLMTKMVIDREA
FT                   FANWHYKNDPTHVIFFSQATFQYLAERDKLELEFIGKDVILLRKTQ"
     gtgcaacaca gttttggcca ctcagtggcc gttcggaaag cgacagcatg gctgtcgctt        60
     tttttatttt ggccgttttt ttacgaaatt ggtgattatt tacccgttgg ctctccaatc       120
     tggggcgact ttctggtatg tttcgcatcc ctgtttgagg aagtccgaat gcatacttgt       180
     cctttatgtc agcatgatca gattctgcac tattttactg acaagcgtcg tgagtatctg       240
     caatgtgcgc gctgtgagtt ggtgtttgtt catcccgagc aacgcttgga tgcaaaaact       300
     gaaaaatctc actatgatct gcatgagaac aatccattgg acctcggtta tcgccgcttc       360
     ttatcgcgta ttaccgatcc tcttttagaa cgaatcgcac cccaatcaaa tggactggat       420
     tttggttgtg gacccggacc aacgctctca ctgatgctag aagagcatgg tcacgttatg       480
     tcgttgtacg atctctatta tcatccagac cgttcagtgc tgagaagaga gtatgatttc       540
     atgacggcta ctgaggtgat cgagcacctc tatgaaccca atgtggtgtg gcaacaatgg       600
     ttgaatttag ttaaacccag aggctggatc ggtctaatga ccaaaatggt gattgatcga       660
     gaagcgtttg cgaactggca ctataaaaat gaccccacgc atgtgatctt ttttagccaa       720
     gcaacatttc agtatctggc agagcgagat aagctcgaac ttgaatttat tggcaaagat       780
     gtaattttac tgaggaagac ccagtaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page