(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0192

BA000037.VV0192      Location/Qualifiers
FT   CDS_pept        203029..203517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92956"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92956"
FT                   /db_xref="GOA:Q7MQ18"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ18"
FT                   /protein_id="BAC92956.1"
FT                   /translation="MSVTLLAIFGGAIILGLASYAGYLLLQLKKQKELQLQHQKLAIEK
FT                   RNANIFDSVNTLCLAGIQGQCDLSEIAIRVYCIMDYVQGEERVDFDATYPAIAELYHIV
FT                   KDMARGEERQKLEKQQRMKQNLERHKAEGRLSEAVIEELKTLQQKVKPLNNQIHIQMI"
     atgagtgtaa ccctactggc catttttggt ggcgcaatca ttcttggttt agcgtcgtat        60
     gctggttacc ttctactcca gcttaaaaag caaaaggagt tgcagctcca gcatcaaaaa       120
     ttggcgattg agaagcgcaa cgccaatatc tttgatagcg taaataccct atgccttgcg       180
     ggcattcagg gtcagtgtga cttatccgaa attgcgattc gggtttactg catcatggac       240
     tacgttcaag gtgaggaacg cgtcgacttc gatgccactt atcccgccat tgcggagctt       300
     taccacatcg taaaagatat ggcgcgtggt gaagagagac aaaagctgga gaaacagcaa       360
     cgcatgaagc aaaaccttga gcgccacaaa gcggaaggtc gcctcagcga agcggtgatt       420
     gaagagttaa aaactctgca acagaaagtg aagccgctga ataatcaaat ccatattcag       480
     atgatctaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page