(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0195

BA000037.VV0195      Location/Qualifiers
FT   CDS_pept        complement(205131..207662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0195"
FT                   /product="GGDEF family protein"
FT                   /note="with 1 transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92958"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92958"
FT                   /db_xref="GOA:Q7MQ16"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ16"
FT                   /protein_id="BAC92958.1"
FT                   /translation="MYELNDSSKISLKAAVITPFVVIFLLSISLVILVQRHSYERAVVD
FT                   LSNKQLSALTENVQTHLTEYLGAPFDAGLAMAHTISFNHLYKADDTSQLQDYFLNAFQT
FT                   LYADIPQLDVIGFGSEAADYIGFRKESNGTHTLMIQDDRTDSKLVIYRGDQISKDIVSV
FT                   IPNYDPRVRPWYAPVAEKRQVMWSSIYANADERQEITLSALSPIYDKQQFVGVMVTDIR
FT                   INTFNAFLNRLQEKTKATVYIMDNDQRLVAHSAQGSVVSWGTEWSKKGDRLLATESADP
FT                   IIKQHAERAKAERMLQHEEAQQFEFETKNERYFSLLSPYTDQYGLTWFIGISISETELL
FT                   GVLPKSQQQSWLIGILVSAIGMSFCLVIFSRITRPITATATAARNLANGNWDSSMPKPG
FT                   RIHETSLLVNAFNEMANNLKASFKALHNQLVFDSLTKLYSREGLIDVSKRKLTESGSLF
FT                   MLGVNRFRDINDSLGHHNGDQLLIKVSERIQTLFDDQFLLARTGGDEFAIYAPHINQSE
FT                   EVTLTVNRLQQLFIAPFYMNDESVVMKVSIGVVITDSDSNMTRWLRNGSIALSNAKQDV
FT                   SGVSYYRPEMADASKFRTQMLAKIQDGIDSQEFIPYYQPIIELKSGKVIGAEALARWLS
FT                   KQGIISPLDFIPIAEDSGLIQKIGSQILRQACHDCAKAIAAQRWDARFQLHVNISVNQL
FT                   LRDDFVAEVSQILQETGLAATNLTLEITESRLVESAHGTLDNMHKLRALGIGIAIDDFG
FT                   TGYSSLAYLHSLPFDCLKIDRTFVEKLNRQEINNSVVAAVVNITKGFNVNVVAEGVETS
FT                   LQAELLMELGCTLAQGYLYSRPVPFDEWPSL"
     atgtacgaac tcaacgacag cagcaaaatt tctctcaaag cagcagtcat cacccctttt        60
     gtggtgattt ttctcttatc gatcagctta gtcattctcg ttcaacgaca cagctatgaa       120
     cgtgccgtgg ttgatctcag taacaagcaa ctctctgcgt taacggagaa tgtacaaact       180
     catctcactg agtatttagg cgcaccgttt gacgcaggtt tggcgatggc acacaccatc       240
     agcttcaatc acctctacaa agctgatgat acctcacagt tgcaagacta tttcttgaat       300
     gcttttcaaa ccctgtacgc cgatatccca caactggatg tgatcggctt tggctcggaa       360
     gcggcggatt acatcggctt tcgcaaagag agcaacggca cacacacatt aatgattcaa       420
     gatgaccgca ccgacagcaa attagtcatt tatcgcggcg atcaaatcag caaagacatt       480
     gtctcggtga tccccaacta cgatccgcgc gtgcgacctt ggtacgcccc cgttgctgaa       540
     aagcgccaag tgatgtggtc atccatctat gccaatgctg acgagcgcca agaaatcacg       600
     ctttccgccc tctcgccaat ttacgacaag caacagtttg tcggcgtgat ggtcaccgac       660
     attcgcatca ataccttcaa cgcgttttta aatcgcttgc aggagaaaac caaggcgacc       720
     gtctacatca tggataacga tcagcgcctc gtcgcacatt ccgctcaagg cagcgtggtg       780
     tcatggggga ctgagtggtc gaaaaagggc gaccgactgt tagccaccga aagtgccgac       840
     cccatcatta agcagcacgc agaacgagcg aaagcagaac gcatgttgca acacgaagag       900
     gcacaacaat ttgagttcga aaccaagaat gaacgttatt tcagcctctt gtcaccatac       960
     accgaccaat atggcctcac gtggtttatt ggcatttcca tctctgaaac cgagcttctt      1020
     ggcgtattgc cgaagtcaca acagcaaagc tggctgatcg gcatactggt aagtgcgatt      1080
     gggatgtctt tctgcttagt cattttcagc cgtatcactc gtcctattac ggccaccgcc      1140
     acggcagcaa gaaatttggc caacggcaat tgggatagct caatgccaaa acctggtcgc      1200
     attcatgaaa ccagcttact ggtcaacgcc tttaacgaaa tggccaataa cctcaaagcg      1260
     tcctttaaag ccctgcataa tcaactggtg tttgattccc tgaccaagct gtacagccga      1320
     gaaggattga ttgatgtaag taagcgcaaa cttactgagt ctggcagttt atttatgctt      1380
     ggggttaatc gctttcgcga tatcaacgac agcttgggac atcacaacgg tgaccaactg      1440
     ctgatcaaag tctccgaacg aatccaaacc ttgtttgacg atcagttttt gctcgctcgc      1500
     acaggaggag acgaatttgc gatatacgct ccccacatca atcaaagcga agaagtgacg      1560
     ttgacggtga atcgccttca gcaactcttc attgccccgt tttatatgaa tgatgaaagt      1620
     gtggtgatga aggtgtcgat tggtgtcgtg atcaccgaca gtgatagcaa catgacacgc      1680
     tggctacgga atggcagcat cgcactgagc aatgcaaaac aagatgtttc gggcgtcagt      1740
     tactatcgtc ctgaaatggc cgacgcttcg aaatttcgca ctcaaatgct ggcaaaaatc      1800
     caagatggta tcgacagcca agaatttatc ccctattacc aacccattat tgagctcaag      1860
     agcggcaaag tgatcggtgc tgaagcactg gcacgctggc tcagcaaaca aggaattatc      1920
     tccccactcg attttatccc tatcgcagaa gacagtggcc tgattcaaaa aattggcagt      1980
     cagattttac gccaagcctg ccatgattgc gccaaagcga tcgccgctca gcgctgggat      2040
     gctcgctttc aactgcatgt gaacatttcc gtcaatcaac tgcttcgcga tgactttgtc      2100
     gctgaggttt cgcaaatttt gcaggaaacg gggttagctg ccactaacct tacgttggaa      2160
     atcaccgagt cgcgcttggt tgaaagcgcg catggcacat tagacaacat gcataagctc      2220
     cgcgctttgg gcattggcat tgccattgac gattttggta ctggctattc ctctctcgcc      2280
     tatctgcatt cgctgccgtt tgattgcctg aagatagacc gaacgtttgt cgaaaaatta      2340
     aatcgccaag aaatcaacaa ttccgttgtc gccgcggtgg tgaacattac taaaggattc      2400
     aacgttaatg ttgtggctga aggggttgaa accagcttgc aagcagagct gctgatggaa      2460
     ttaggatgca ccctagcgca aggttatctc tatagccgcc cggtgccatt tgatgagtgg      2520
     ccatcgctat aa                                                          2532
//

If you have problems or comments...

PBIL Back to PBIL home page