(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0197

BA000037.VV0197      Location/Qualifiers
FT   CDS_pept        complement(209209..210261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0197"
FT                   /product="nitrogen regulation protein NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92961"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92961"
FT                   /db_xref="GOA:Q7MQ13"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ13"
FT                   /protein_id="BAC92961.1"
FT                   /translation="MKVNSALSNTILSNMVTATLILDDELQIHHANPAAEQLFSQSAKR
FT                   IVHHPLSQLIQHASLDLALLSQPLQSGQSITDSDVTFVVDGKPLLLEVTVSPISIEREL
FT                   MLLMEMRKVDQQRRITQEMNQHAQQQAAKLLVRGLAHEIKNPLGGLRGAAQLLEKMLPD
FT                   PSLTEYTQIIIEQADRLRALVDRLLGPQKPGKKQQTNLHQVLEKVRQLVELESEQTLVI
FT                   ERDYDPSLPDIYIDADQIEQAMLNIVSNASQILAHQEDGKISIRTRTVHQANIHGQRCK
FT                   VAARIEIMDNGPGIPVELQDTLFYPMVSGREGGTGLGLSISQNLIDQHNGKIDVESWPG
FT                   HTNFTIYLPI"
     gtgaaggtga attccgctct ctcaaatacc atactcagca acatggtgac tgcgacgctc        60
     atcttggatg atgagctgca aatacaccac gccaatcctg cggcagagca attgttttct       120
     caaagtgcca agcggattgt gcaccaccca ctctcgcagt tgattcagca tgcgtcgctc       180
     gatctcgcct tgctttcaca gccattacaa agcggacaaa gcattaccga cagtgacgtc       240
     actttcgtgg tggatggcaa acctttgttg ctggaggtta cagtcagccc gatttcaatc       300
     gaaagagagc tgatgctctt gatggagatg cgtaaagtcg accaacagcg ccgaatcact       360
     caggagatga accagcacgc ccaacaacaa gccgcaaagc tcttggtgcg aggcctcgct       420
     catgaaatca aaaacccgct aggaggtcta cgtggcgcag cacaactgct ggaaaaaatg       480
     ctgcccgatc cttcattaac ggaatacacc cagatcatta ttgagcaggc agaccgattg       540
     cgcgcgttag tcgaccggct actgggccca caaaaaccgg gcaaaaaaca acaaaccaac       600
     cttcaccaag ttctcgaaaa agttcgccaa cttgtggagc tggagtccga acaaacgctg       660
     gtcatcgagc gagactatga tccaagcttg cccgatattt acattgatgc tgaccaaata       720
     gagcaggcga tgctcaatat cgttagcaat gcttcgcaaa ttttggctca ccaagaggat       780
     ggtaaaatct ccattcgcac cagaacggtg catcaggcca atatccatgg ccaacgctgc       840
     aaagtggcgg cccggattga aattatggat aacgggccag gtatccccgt tgagcttcaa       900
     gatactttgt tttaccccat ggtcagtggt cgagaaggcg ggacaggatt aggtctctct       960
     atctcacaaa accttattga tcagcataac ggcaaaattg atgtcgaaag ctggccaggg      1020
     cacaccaatt ttacgattta tctgccaatt taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page