(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0198

BA000037.VV0198      Location/Qualifiers
FT   CDS_pept        complement(210390..210926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92962"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92962"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ12"
FT                   /protein_id="BAC92962.1"
FT                   /translation="MKLLFALVLSLSAPLVCAQTVYTWVDDNGVLHMSDTPNNGAKTVK
FT                   LPDLEASAPPPQVESTQSLDKPAELTKEKPKSQQQEAVPLALTLASPSHDATIRSNQGI
FT                   ITIQVQTNRKLDIGEQLQLVFDGNRYGAPQTSTLWQLKNIDRGTHIIAIQAVRSGKLIA
FT                   STSPISVHLHRTKIK"
     atgaaattgc tttttgctct ggttctctct ttgagcgccc ctttagtgtg cgcccaaact        60
     gtctacactt gggtcgatga caacggcgtg ctccacatga gcgatacccc caacaatggc       120
     gcgaaaaccg tcaaactgcc cgatctcgaa gccagtgccc cccctcctca agtggaatca       180
     acccaatctc tcgataaacc agcagagctg accaaagaga aaccgaaaag ccaacagcaa       240
     gaggcggtac ctcttgcgtt gacactggcg tctcccagcc acgatgccac gattcgcagt       300
     aatcaaggga tcatcaccat tcaggttcaa accaaccgta agctggacat tggcgagcaa       360
     ctgcaactgg tgtttgatgg caatcgctac ggtgctccac aaacctcaac attgtggcag       420
     ctcaaaaaca tcgaccgcgg cacgcacatt attgccattc aggccgtacg aagcggcaag       480
     cttattgcat caactagccc tatatcagtg catcttcatc gcaccaagat aaaatag          537
//

If you have problems or comments...

PBIL Back to PBIL home page