(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0210

BA000037.VV0210      Location/Qualifiers
FT   CDS_pept        223925..224086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0210"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92975"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92975"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ9"
FT                   /protein_id="BAC92975.1"
FT                   /translation="MNLALYNGDLPQIFQGSWQNRNQRGVSQASCDIVQSSVSKRDLST
FT                   QQQHNVLF"
     ttgaatcttg cactttacaa tggtgactta ccgcaaattt ttcaaggcag ttggcaaaat        60
     cggaatcaga gaggcgtgtc acaagcaagc tgtgatatag tgcaaagctc tgtgtcgaag       120
     cgagatttat cgacgcaaca acagcataac gtgctgtttt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page