(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0226

BA000037.VV0226      Location/Qualifiers
FT   CDS_pept        complement(236504..237058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0226"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92990"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92990"
FT                   /db_xref="GOA:Q7MPY5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY5"
FT                   /protein_id="BAC92990.1"
FT                   /translation="MSRRKEPDILNRNVVAQSRLFSIESLELRFSNGEERIYERLKPSG
FT                   KNAVMMVPVTEQGDLLLVREYAAGTERYELGFPKGLIDQGESAEQAADRELKEEIGFGA
FT                   KQLTPLKQVVLAPSYFSSKMTLFLAQDLYPETLEGDEPEPLEVVRWPLVQAEELLHHLD
FT                   FCESRSITALLLALRALRPAK"
     atgagcagaa ggaaagaacc cgatattctc aatcgtaatg tcgttgccca atcacgactc        60
     ttttctatcg aaagccttga actgcgtttc tccaacggcg aagagcgaat ttacgagcgc       120
     ctcaaaccaa gcggtaaaaa tgccgtgatg atggttcccg ttactgagca aggtgaccta       180
     ttattagtga gagagtacgc tgcaggtaca gagcgctatg agcttggctt ccctaaaggg       240
     cttattgatc agggagaaag cgccgaacaa gcagcggatc gggaattgaa agaagaaatc       300
     ggctttggcg cgaaacaatt aacgccattg aagcaagtgg tgctggctcc ttcctatttc       360
     tcaagcaaaa tgacgctgtt tttggcacaa gatctgtatc cagaaacatt ggaaggcgat       420
     gagccagagc cgcttgaagt ggttcgttgg ccactcgtgc aggcagaaga acttcttcat       480
     cacttagatt tttgtgaatc ccgcagtatc acagcgctac tattggcact gagagcactt       540
     cgaccggcca agtag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page