(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0233

BA000037.VV0233      Location/Qualifiers
FT   CDS_pept        239593..240063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92997"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92997"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX8"
FT                   /protein_id="BAC92997.1"
FT                   /translation="MIVSPTTVSVPLIAPSVNVQTEQAARDNRVREPVAPTVALAKSNA
FT                   ERKVKSDDKRRRQSSWDPSEHPGYEMETNTQEISVYHEDPKDTLERLFGLLALRSYSEE
FT                   QGKGYAMRYRLPKRILDAAIREGIMEKRRAIIKYHYGHSVAPHTPSEVIAVL"
     atgatagtgt caccgaccac tgtgagtgtg ccactgatcg ccccatcggt aaatgtgcag        60
     acagagcagg ccgcgcgcga caacagagtg cgtgaacctg tggcgccaac cgttgcgttg       120
     gccaaatcta acgcggaacg taaagtcaaa agtgatgata aacgccgacg tcaatcttcg       180
     tgggatcctt cagagcaccc tggctatgag atggaaacca atacgcaaga gatctcggtc       240
     tatcatgaag accctaaaga tacgcttgag cggctttttg gacttctggc actgcgaagt       300
     tacagtgaag aacagggtaa aggctacgca atgcgctatc gtctgcccaa acgtatcttg       360
     gatgcggcga taagagaagg gatcatggag aagcgtcgag cgatcatcaa gtaccattac       420
     ggtcactctg tcgcgcctca taccccttca gaagtgattg cggtgttata g                471
//

If you have problems or comments...

PBIL Back to PBIL home page