(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0234

BA000037.VV0234      Location/Qualifiers
FT   CDS_pept        complement(240147..242438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0234"
FT                   /product="transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92998"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92998"
FT                   /db_xref="GOA:Q7MPX7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX7"
FT                   /protein_id="BAC92998.1"
FT                   /translation="MSQAICRLIAQELNVRPEQVTAAVALIDDGNTVPFIARYRKEVTG
FT                   GLDDTQLRNLDSRLSYLRELDDRRQTILKSIQEQGKLTAELESEILTADSKTRLEDLYL
FT                   PYKPKRRTKGQIAIEAGLEPLADTLWNHPQTEPESEAIRYINADKGVEDSKAALDGARA
FT                   IIMERIAEDANLLEKIRQYLNRHAEIVSRVVAGKEHEGEKFKDYFEHNEAISKVPSHRA
FT                   LAMLRGRNEGFLSLTLNADPQQEESVRQSYCETLIADHYGVTLSNAPADNWRKQVISWA
FT                   WRIKVSMHMETELMAAMKERAEIEAIEVFATNLKDLLMAAPAGPRATLGLDPGLRTGCK
FT                   VAVVDATGKVLATDTIYPHVPQNQYDRAMQTVAALIKQHNVDLIAIGNGTASRETDAFA
FT                   ADLIQRGNLKVQKIMVSEAGASVYSASELAAKEFPNMDVSLRGAVSIARRLQDPLAELV
FT                   KIDPKSIGVGQYQHDVSQSMLAKRLDAVVEDCVNAVGVDVNTASAALLTRVAGLSTTLA
FT                   QNIVDFRDEHGRFDSRTTLKKVPRLGPKAFEQCAGFLRIMDGKNPLDASSVHPEAYPVV
FT                   KAIAEKNQKAVKALIGDSSFLKGLRAVDYTDEHFGVPTVTDIIKELDKPGRDPRPEFKT
FT                   ATFAEGIHNVSDLEVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALTDRFVSDPREV
FT                   VKAGDIVKVKVMEVDVQRKRIALSMRLNDEPGQDNRSQRAAAPRRHDNDNTLGGAMGGA
FT                   FAAAFAKAKK"
     atgagccaag ctatctgtcg tctgattgct caagagctga atgttcgccc tgagcaagtc        60
     actgctgccg ttgccctaat tgatgatggc aacaccgttc cttttatcgc ccgttaccgt       120
     aaagaggtaa ctggtgggtt agatgatact caattgcgca accttgatag ccgtttgtcc       180
     tatctgcgcg agctggatga ccgtcgccaa accattctta aatcgattca agagcaaggc       240
     aaacttaccg ctgaactgga aagtgagatc ctcactgccg acagcaaaac gcgccttgaa       300
     gatctgtatc tgccttataa gccaaagcgc cgtaccaaag ggcaaatcgc gattgaagca       360
     ggcctagagc cactggccga tacactttgg aaccacccgc aaaccgagcc agaaagcgaa       420
     gcgatccgct acattaatgc cgacaaaggg gtggaagaca gcaaagccgc gctcgatggc       480
     gcacgtgcca tcatcatgga gcgcattgcc gaagacgcca acttgctgga gaaaattcgc       540
     cagtacctca atcgtcatgc tgaaattgtg tcacgcgtgg tggcgggcaa agagcacgaa       600
     ggcgagaagt tcaaagatta ctttgagcac aacgaagcga tcagcaaagt gccttctcac       660
     cgcgctttgg cgatgctgcg cggccgaaac gaaggcttcc tcagcctgac actcaatgcc       720
     gatccacaac aagaagaaag tgtacgccaa tcctattgcg aaaccctgat tgccgatcac       780
     tatggcgtga cgctgagcaa cgcccctgct gacaactggc gcaagcaggt catcagttgg       840
     gcgtggcgca tcaaggtgtc aatgcacatg gaaaccgagt tgatggcggc aatgaaagag       900
     cgcgcggaaa tcgaagcgat tgaagtgttc gccaccaacc tcaaagatct gttgatggca       960
     gcgcctgcgg gcccgcgtgc gacgcttggc cttgaccctg gcctgcgcac cggctgtaaa      1020
     gtcgcggtgg tggacgccac cggtaaagta ctggccaccg acaccattta cccacacgta      1080
     ccgcagaacc aatacgatcg cgccatgcaa acggtggcgg ccttgatcaa gcaacacaat      1140
     gtcgatttga ttgcgattgg taacggcacg gcttcacgcg aaaccgatgc ctttgctgcg      1200
     gatttgattc agcgtggcaa tctcaaagta cagaaaatca tggtcagcga agcaggcgct      1260
     tcggtctact ctgcctcaga actggcggcc aaagagttcc cgaatatgga cgtgtcactg      1320
     cgtggcgcag tgtcgattgc tcgtcgcctg caagacccac ttgccgaact ggtgaaaatc      1380
     gatccgaaat cgatcggtgt cggccagtac cagcacgacg tgagccaatc catgctggcc      1440
     aaacgccttg atgcggtggt ggaagattgt gtaaacgcgg tcggtgtgga tgtaaacacc      1500
     gcttctgccg cgctgctgac ccgcgtggcg ggtctctcga ctactttggc gcagaacatt      1560
     gttgattttc gtgatgaaca tggccgtttc gatagccgca ctacgctgaa aaaagtgcca      1620
     cgtttggggc caaaagcgtt tgagcagtgt gcgggcttcc tacgtattat ggatggcaaa      1680
     aacccgctcg atgcttcttc ggttcaccct gaagcctacc ctgtggtcaa agcgattgcc      1740
     gagaaaaacc aaaaagcggt caaagcgctg attggcgatt cgagcttcct taaaggattg      1800
     cgcgcggtgg attacaccga tgaacacttt ggtgtgccaa cggtgaccga catcatcaaa      1860
     gagttggata aaccgggccg agaccctcgt cctgaattca aaaccgccac cttcgccgaa      1920
     ggcattcata atgtgtccga tctcgaagtg gggatgattc ttgaaggggt agtatcaaac      1980
     gtggccaact ttggcgcctt tgttgacatc ggcgttcacc aagatggctt ggtgcacatt      2040
     tcagcgctga ccgatcgctt tgtttctgat ccgcgtgaag tggttaaagc gggcgacatt      2100
     gttaaagtca aagtgatgga agtggatgtg caacgcaagc gtatcgcact gtcgatgcgt      2160
     ctcaatgatg agccggggca agacaatcgc agccaacgcg ctgccgcgcc acgtcgccat      2220
     gacaacgaca atacacttgg cggtgccatg ggtggtgcgt ttgccgccgc gtttgccaaa      2280
     gcgaaaaagt aa                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page