(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0237

BA000037.VV0237      Location/Qualifiers
FT   CDS_pept        244169..245467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0237"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93001"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93001"
FT                   /db_xref="GOA:Q7MPX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX4"
FT                   /protein_id="BAC93001.1"
FT                   /translation="MRFRSSFTQSIFIFITLLLASQVFSYYAVFNYALLPSLQQFNKIL
FT                   AHELNLVLDDDSALMADAPLRRQVLEQLGVTVHAADSEQAKEFDHAMTIDLMSEEMTHE
FT                   LGSPTEVRLLLGSESYILWMKIDALPGSLIRIPLSELQEEDFAPLFRNSLIVALLIIAG
FT                   GWLFIRLQNRPLIALEKAAKEVGRGEIPPPLPEKGATEIRAVTRAFNQMSRGIQELEAD
FT                   RALLMAGISHDLRTPLTRIRLATEMMSPEDSYLAEGIISDTEECNEIISQFMDYLKPVN
FT                   TQSFTEVDINGISGDVASSEGGYEVQIETAFQPSIRTAFGSPIAIKRAVSNLVVNALRY
FT                   GNGWVKISTGMTADSKLVWVCVEDNGPGIEKSQVAKLFEPFTRGDTARGSEGTGLGLAI
FT                   VKRIVSQHHGSVVVNNRSEGGLKVQLSFPTSER"
     atgcgttttc gtagttcctt tacccaatcg atatttatct tcattacgtt gctgctcgcc        60
     agtcaggtgt tctcctatta cgcggtgttc aactacgcgc tattgccgag tttgcagcag       120
     ttcaacaaaa tcctcgccca tgagctgaat ttggtgctcg atgacgacag cgctctgatg       180
     gcggatgcgc cgttgcgtcg gcaggttttg gagcaacttg gtgtgacggt gcacgcggcc       240
     gatagtgaac aagccaaaga gtttgaccat gcgatgacca tcgatttgat gagtgaagag       300
     atgactcacg agcttggttc gccaaccgaa gtgcgtctgc tgttgggcag cgaaagctac       360
     attttgtgga tgaaaattga cgcgcttcca ggttcactga tccgcattcc gctctctgaa       420
     ctgcaagaag aagatttcgc tccactgttt cgcaacagtt tgattgtggc gctgttgatc       480
     atcgctggtg gttggctgtt tatccgttta caaaaccggc cactcatcgc gctggagaag       540
     gcggccaagg aagtcggtcg aggggaaatc ccgccaccgc tgccagaaaa aggggccaca       600
     gagatccgtg cagtgacgcg cgcgttcaat caaatgtctc gcggcattca agagttggaa       660
     gctgaccgcg cgttgttgat ggcgggtatt agccatgatt taagaacgcc gttaacacga       720
     attcgccttg cgactgaaat gatgtcacca gaagacagct atttagcgga agggatcatc       780
     agtgatactg aagagtgtaa tgagatcatc agccagttta tggactacct caaaccagtg       840
     aatacgcaaa gtttcaccga ggtcgacatc aatggtattt ctggggatgt agcgagctcc       900
     gaagggggtt acgaagtaca gattgagacc gccttccagc cttcgattcg caccgctttt       960
     ggcagcccga tcgcaattaa gcgtgccgtg agcaacttag tggtcaatgc actgcgttac      1020
     ggtaatggat gggtgaaaat cagcacgggg atgaccgcag acagcaagtt ggtgtgggtg      1080
     tgtgtggaag ataacggccc agggattgaa aaatcacaag tggcgaagtt gtttgaacct      1140
     ttcacccgtg gcgatacggc tcgtggtagc gaaggaaccg gcttagggct ggccattgtc      1200
     aaacgtattg tcagccagca tcacggctcg gtggtggtga acaaccgcag cgaaggtggg      1260
     ctcaaagtac agttgagctt tccgaccagc gaacgttag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page