(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0243

BA000037.VV0243      Location/Qualifiers
FT   CDS_pept        complement(252786..253409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0243"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93007"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93007"
FT                   /db_xref="GOA:Q7MPW9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPW9"
FT                   /protein_id="BAC93007.1"
FT                   /translation="MGKGTLYIVSAPSGAGKSSLISAMLEKNPTYAMKVSVSHTTRGMR
FT                   PGEQDGVHYHFVEKEHFEDLITKGEFLEYAEVFGNYYGTSRVWIENTLDKGIDVFLDID
FT                   WQGARQIREQMPHAKSIFILPPSNGELERRLNTRGQDSEAVIAKRMAEAKSEISHYNEY
FT                   DYVIINDDFDTALMDFKAIIRAERLKQDKQAAKYSGMLDALLAE"
     atgggcaaag gtactcttta catcgtctct gctccaagcg gtgcaggcaa atccagctta        60
     atctccgcga tgctggagaa aaacccgact tacgcaatga aagtgtcggt ctctcacacc       120
     acacgtggca tgcgcccagg tgaacaagat ggcgtgcact accactttgt cgagaaagag       180
     cattttgaag atctgattac caaaggcgag tttctggaat acgcagaagt gtttggtaac       240
     tactacggca cctcacgtgt ttggattgaa aacaccctag ataaaggcat tgatgttttt       300
     ctcgatatcg attggcaagg cgctcgtcaa attcgtgagc aaatgccaca cgctaagagc       360
     atctttatct taccaccatc caacggtgaa cttgagcgtc gtcttaatac acgcggtcaa       420
     gacagcgaag cggtgatcgc caagcgcatg gcagaagcga aatccgaaat ctcgcactac       480
     aacgaatacg attacgtgat catcaacgat gatttcgata ctgctttgat ggactttaaa       540
     gccattatcc gagcagaaag attgaagcaa gacaaacaag ctgctaaata tagcggtatg       600
     cttgacgcgc ttttagcgga ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page