(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0245

BA000037.VV0245      Location/Qualifiers
FT   CDS_pept        complement(254923..255555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0245"
FT                   /product="periplasmic protein TonB2"
FT                   /note="links inner and outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93009"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93009"
FT                   /db_xref="GOA:Q7MPW7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW7"
FT                   /protein_id="BAC93009.1"
FT                   /translation="MRYLASIALALVVSLGLFWGMDKLVNKERHELASNDDLRMVDFIR
FT                   VKPEEKVQEKKRELPKPPPPKRPPPPPEMKITSTVKPVMEQIPMDMPKLDLPVNITGGS
FT                   VLGHYSQGGGAQVAGTGGPMPLATFQPQMPRKAAKAGLEKGLVVLEFTVNERGGVEDIK
FT                   VLKEEPRRMDLGKEARKTVSKWTFKPKMVDGKPVSSRMAQEIEFSVN"
     atgcgttatc tggcctcaat tgcactggcg ctcgttgtct ccctcggatt gttctggggg        60
     atggacaagc tggtaaataa agagcgccac gaactggcat cgaacgatga tctgcgcatg       120
     gtggatttca ttcgagtcaa acccgaagaa aaagtacagg agaaaaaacg cgagctaccc       180
     aaaccgccac cgccgaaacg tccaccacca ccgccggaga tgaagatcac ctccacagta       240
     aaaccggtga tggaacagat ccctatggac atgcctaagc tggatctgcc cgtcaacatt       300
     actggtggtt ccgttcttgg tcattattcc caaggtggcg gggcacaagt agccggcact       360
     ggtggcccga tgccattagc gactttccag ccgcaaatgc cgcgtaaagc cgccaaagcg       420
     ggattggaaa aaggtttggt tgttcttgag ttcaccgtca acgagcgtgg cggggtggaa       480
     gacatcaaag ttctcaaaga ggaacctcgc cgcatggatt tgggtaaaga agcacggaaa       540
     accgtgtcga aatggacctt taaacccaag atggtcgatg gcaaacctgt gagctctcgt       600
     atggctcaag aaattgagtt ctcggtaaat taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page