(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0249

BA000037.VV0249      Location/Qualifiers
FT   CDS_pept        complement(257950..258774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93013"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93013"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW3"
FT                   /protein_id="BAC93013.1"
FT                   /translation="MAREMPAPFSTDKNTDKDATMTLKKFGVSALTAAMLSLTGSALAA
FT                   DAGSVISTQAGTNKAAQASQDKIDGYADSTDTMLAEYKAIMRQVDSMKVYNEQINRMVQ
FT                   SQQGELDSLDRQIAQIDQTAMEVVPLTLKMIDALDEIVTLDLPFQTKERNKRINELREL
FT                   MDRADVTTSEKFRKVMEAYQIEEGFSRSIESYKASLDRNGEVVTYDFLRIGRTALLYQS
FT                   PDGVETGMWNQQTRQWEALPESYRIAVQQGIRIAKKQAPPALIKLPVFAGEE"
     ttggcgcggg aaatgcccgc gcccttttcg actgacaaaa acactgacaa ggatgcaacc        60
     atgacgttaa agaaatttgg cgtgagtgca ctcaccgcag cgatgctgag cctaacaggc       120
     agcgcgttag ccgcagacgc aggaagcgtg atttccactc aggcaggcac caataaagcc       180
     gctcaagcct ctcaagacaa aatcgatggc tacgcggata gtaccgacac catgctcgcc       240
     gaatacaagg ccatcatgcg ccaagtagac agcatgaaag tctacaacga gcagatcaat       300
     cgcatggtgc aatcgcagca aggcgaactg gattcattag atcgccaaat cgcgcagatt       360
     gaccaaaccg cgatggaagt ggtgccactg actttaaaaa tgattgatgc gctcgacgaa       420
     atcgtcacgc tcgatctgcc attccaaacc aaagaacgca acaaacgaat caacgaacta       480
     cgcgaactaa tggatcgcgc agacgtcacc acctcggaaa aattccgtaa agtgatggaa       540
     gcgtaccaaa tcgaagaagg cttctctcgt tccatcgaat cttacaaagc cagcttagat       600
     cgcaatggtg aagtggtgac ttacgacttt ctacgcattg gtcgtaccgc gttgctctat       660
     caatcgccag acggtgttga aaccggcatg tggaaccagc aaacccgcca atgggaagcg       720
     ctgcctgaaa gctaccgtat tgccgtgcag caaggaattc gtatcgcgaa aaaacaagcg       780
     ccaccggctc tgatcaaatt gccagtgttt gctggggagg aataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page