(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0256

BA000037.VV0256      Location/Qualifiers
FT   CDS_pept        268030..268473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93020"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93020"
FT                   /db_xref="GOA:Q7MPV6"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV6"
FT                   /protein_id="BAC93020.1"
FT                   /translation="MLGMLQVPSHLPKSFSRPFLKIFHILEAVLLVAITLATLYAMVQE
FT                   FIHVFVEKRVLLTDILLMFIYLEVLAMVQQFVMNGKIPVRYPIYIAMMAIARYITLGMK
FT                   ELDATLVVWLSVAAFVLAAATLLIRVGHHYWPYVDNHTAEKDE"
     ttgcttggaa tgttacaagt gccgtcacat ctacctaaat cattcagtcg cccattctta        60
     aaaatctttc atatcttgga agcggtcttg ctggttgcca tcactctggc cacgctttat       120
     gccatggtgc aagaattcat tcatgtgttt gtggaaaaac gggtgctact caccgacatc       180
     cttttgatgt ttatttatct cgaagtgctg gcgatggtgc agcagtttgt gatgaacggt       240
     aagattccag tccgctatcc gatttatata gcgatgatgg cgattgcacg ttacatcacg       300
     ttagggatga aagaactcga tgcgaccctt gttgtgtggc tctctgttgc tgcgtttgtt       360
     ttggcggctg ccacgttgct gatacgtgtg ggtcaccact actggccgta tgtggataat       420
     cacacagcag aaaaagacga atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page