(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0261

BA000037.VV0261      Location/Qualifiers
FT   CDS_pept        complement(270633..271952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93025"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93025"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV1"
FT                   /protein_id="BAC93025.1"
FT                   /translation="MTMQRNLLNALIAWKSQPVRKPLLIDGARQTGKTYLLQELFGNTF
FT                   ANILRIDFLENPAYKEAFDGSLSPDELVMNIELLTNQAFNPDTDLLILDEIGECERAVT
FT                   SLKYFAEKAPSYFVAASGSNIGLLNTFPVGKVEQYNLRPLTFQEFIYASNEQALIKAFD
FT                   SQASTPAVHTKLMDKLTDYFFTGGMPEAVSAWYQFKDSSILERVEKVTKIHADLVEGYR
FT                   RDFGKYAGKVDATLIESVFNSIPAQLSLVSDESVKRFKFKHVHERKSRYSDFETAIHWL
FT                   NCCRLALPNYPIEGLPKSPLAAYKKDNMVKLFLFDVGLLNHMLGSSYKEIKQQNYEYKG
FT                   YVAENFVQQELTAIGVDPSYSWNDARAEIEFILATDEGDIIPVEVKSGKRTRAKSLASY
FT                   VEKCTPNKTFKLTGTQGSSALEQTNIVMPLYFTQYLPERW"
     atgacaatgc agcgcaactt actcaacgcc ctaatagcat ggaaaagtca acctgtgcgc        60
     aagccattat tgatcgatgg cgcaagacaa acaggtaaaa cctatctact gcaagagttg       120
     tttgggaata cctttgccaa catccttcgt atcgacttcc ttgaaaaccc agcttacaaa       180
     gaagcgttcg atggctcgtt gtcacctgac gagctagtaa tgaacattga gttgttaacc       240
     aaccaagcgt tcaatccaga caccgacttg ctgatattag atgaaattgg cgaatgtgaa       300
     cgagccgtaa cttcgctgaa gtattttgcc gaaaaagcac cgtcctattt tgtcgcagcc       360
     agcggttcaa atattggttt gctcaacacc ttccctgtgg gcaaggtaga acaatacaat       420
     ttacgaccac tgaccttcca agaatttatt tacgcatcca acgagcaagc actgatcaaa       480
     gcatttgata gtcaagcaag cacaccggcg gtgcacacta aattgatgga taaactaacc       540
     gactattttt ttaccggtgg tatgccggaa gccgtttctg cttggtatca gtttaaggat       600
     tcaagcattc tagagcgtgt tgaaaaagtc acaaaaattc atgccgattt agttgaaggt       660
     tatcgccgcg atttcggtaa gtacgcgggc aaggtcgatg ccacactgat tgaatcggtg       720
     tttaatagca ttccagccca gctatcactt gtcagcgatg agtcagttaa acgctttaaa       780
     tttaagcatg tgcatgagcg taaatctcgt tatagcgatt ttgaaaccgc gatccattgg       840
     cttaactgct gccgcttagc tttgccaaac taccctattg aaggattacc gaaatctccg       900
     ttggcggcct ataaaaaaga caatatggtt aaactatttc tgtttgatgt gggtctgctc       960
     aatcatatgc tgggcagcag ttataaagag attaagcaac aaaactatga atacaaaggc      1020
     tatgtggctg aaaactttgt gcaacaagag ctcacagcta ttggcgttga cccaagctat      1080
     tcatggaatg acgcccgcgc cgaaatcgaa tttattttgg cgaccgatga aggcgatatc      1140
     atccctgtgg aagtcaaaag tggtaaacgt acaagagcaa aatcgttggc atcctacgtt      1200
     gaaaaatgta ctccaaataa aacctttaag ttaacgggta cacaaggctc ttcagcgtta      1260
     gaacaaacca atatcgtgat gcctttgtat ttcacgcagt atttaccaga gagatggtaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page