(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0262

BA000037.VV0262      Location/Qualifiers
FT   CDS_pept        272326..272583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93026"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93026"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV0"
FT                   /protein_id="BAC93026.1"
FT                   /translation="MRKQTMNPTTQSPTNSVHPARQQRILRLPEVKAKTGFGRSTIYAL
FT                   MASGEFPRSIRIGARAVGWLESDIDQWIETRRIGAAYGRG"
     gtgaggaagc aaacgatgaa cccaacgaca caatcaccca caaactcagt acacccagcg        60
     cgtcagcagc ggattttgcg cttgcccgag gtaaaggcca aaacaggctt tggccgcagc       120
     accatttatg ccctgatggc cagcggtgaa tttccacgtt ccattcgtat tggtgcgcgt       180
     gccgtgggct ggttagaaag cgatatcgac cagtggattg aaacccgccg tatcggtgct       240
     gcttatggcc gtggataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page