(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0265

BA000037.VV0265      Location/Qualifiers
FT   CDS_pept        274695..277148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0265"
FT                   /product="type I site-specific restriction-modification
FT                   system, R (restriction) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93029"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93029"
FT                   /db_xref="GOA:Q7MPU7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="PDB:3H1T"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU7"
FT                   /protein_id="BAC93029.1"
FT                   /translation="MRWISGLDLVAHQMTARKKNSMALNEADTCRVYVTPKLKESGWEN
FT                   NPSAITEQYTFTDGRVQFKGSKVQRGEQKRADYLLKYTRDFPIAVVEAKPENSPVGQGM
FT                   QQAKDYAEILGLKFAYSTNGHEILEFDYTTGEEQLLSRFPTPDELFKRLCGDEGIKDED
FT                   LDTLLSPYHHVSGYSPRYYQQIAINRAVQSVLQGKKRSLITMATGTGKTVVAFQISWKL
FT                   WSARWNRTGDYRKPRILFLADRNVLVDDPKDKTFTPFGDARHKIEGGKVVKSREIYFAI
FT                   YQSIASDERRPGLYKEFPQDFFDLIIIDECHRGSARDNSNWREILEYFEPAFQIGMTAT
FT                   PLREDNRDTYRYFGNPIYTYSLRQGIDDGFLAPYRVHRVISEVDAAGWRPSKGDVDRFG
FT                   REIPDGEYQTKDFERVIALKARTDAFAKHLTDFMKRTDRFAKTIVFCVDQEHADEMRRA
FT                   LNNLNSDLSRKHPDYVARVTSEEGKIGKGHLSRFQELETSTPVILTTSQLLTTGVDAPT
FT                   CKNVVLARVVNSMSEFKQIVGRGTRLREDYGKLWFNIIDYTGSATQNFADPDFDGYPEI
FT                   EDEVVIDEDGEEVVDDTLTPESEVLEVAEETGEYEVNTEGEGADDEEEHEPRKYYVDGG
FT                   SVKITSHLVYELDEDGKQLRVIQYTDYTAEKVKTLFSSLDELKDSWANPLKREEIILEL
FT                   QERGIQFEDLVAESGKTDADPLDLLCHIAFNVPLRTRKERADYLKKNKPDFFDQYGPEA
FT                   RAILTSLLDKYTDHGPKQFSIPDSLQVPPISEYGNVMEIANLFGGALQMKTAVDQLQTL
FT                   LYSQQ"
     atgaggtgga tcagtgggtt agatctggtg gcgcatcaga tgacagcaag gaagaaaaat        60
     agtatggcct taaacgaagc agatacttgc cgggtctatg tgacgccaaa gctcaaagag       120
     tctggatggg aaaacaatcc tagcgcaata actgaacagt acacatttac cgatggtcgt       180
     gttcagttta agggcagtaa agttcaacgt ggggagcaaa agcgagcgga ttatttactt       240
     aagtacactc gcgattttcc tattgccgtt gttgaggcta aacctgaaaa cagccctgtt       300
     ggccaaggga tgcaacaggc aaaagattac gcagaaatct tagggctaaa gtttgcttac       360
     tcaaccaatg gtcatgagat cttagaattt gactacacca ctggtgaaga gcaattgttg       420
     tcgcgctttc caacccctga tgagttattc aagcgtcttt gtggcgatga aggtataaag       480
     gatgaagatc ttgatacctt gctgtcccct taccaccatg tttcgggata ttccccgcgc       540
     tactaccaac aaatagctat aaaccgcgca gttcagtcgg tgcttcaagg taaaaagcgc       600
     tcattaatta cgatggcaac gggtacgggt aagactgtcg tcgcttttca aattagttgg       660
     aagctgtgga gtgctcgctg gaatcgtacg ggagactaca gaaagcctcg cattctattt       720
     ttggcagata gaaatgtgtt ggtcgatgac ccaaaggata aaacatttac tccgtttggt       780
     gatgcaaggc acaaaattga aggtggcaaa gttgttaaaa gtcgtgaaat ttattttgcc       840
     atttatcagt ccattgccag tgatgagcgt cgtccaggct tgtataaaga atttccgcaa       900
     gacttctttg atctaattat cattgatgaa tgtcaccgag gcagtgcccg cgacaacagt       960
     aactggcgcg aaattctgga gtattttgag ccagcctttc aaatcggtat gacggcgacg      1020
     ccgcttcgtg aagataaccg cgatacttat cgttattttg gcaacccaat ctacacctac      1080
     agtttgcgcc aaggtattga tgacggattt cttgctccat accgcgtaca ccgagttatt      1140
     tcggaagtcg atgcggcagg ttggcgacca agcaaaggcg atgtagaccg ctttggacga      1200
     gaaatcccag atggtgaata ccaaaccaag gactttgaac gggttattgc gttaaaggct      1260
     cgaacagatg cgtttgctaa gcatctcacc gactttatga agcgaaccga tcgttttgca      1320
     aaaacgatcg tgttttgtgt cgaccaagaa cacgccgatg aaatgcgtcg ggcgcttaat      1380
     aacttgaatt ctgacctttc acgcaagcat ccagattacg ttgcacgcgt gacatcagaa      1440
     gaagggaaaa ttggcaaagg gcacctcagt cgttttcaag agttggaaac cagtactcca      1500
     gtgatactga ccacttcaca gttattaaca acgggggtcg atgcgccaac ctgtaaaaat      1560
     gttgtgcttg cgcgtgttgt gaactcaatg agtgagttca agcaaattgt tggccgtggt      1620
     actcgcctac gcgaagatta cggcaagctg tggttcaaca tcattgatta taccggctcc      1680
     gccacacaaa attttgctga tcctgacttt gacggttacc cagaaattga agatgaagtg      1740
     gtgattgatg aagacggtga agaagtggtt gatgacactt taacaccaga gagtgaagtg      1800
     ttagaggttg ctgaagagac gggcgaatac gaagtgaata ctgaaggtga aggcgctgat      1860
     gatgaagagg agcacgaacc gagaaagtat tacgtagacg gtggcagcgt taaaattacg      1920
     tctcatttgg tctatgagct agacgaagac ggtaaacagc ttcgcgtcat ccaatatacc      1980
     gactataccg cagaaaaggt aaagaccctc ttttcctcac tggatgaact aaaagatagc      2040
     tgggctaatc cgttaaagag agaagagatc attctcgaat tacaagaacg agggatccag      2100
     tttgaagatt tggtcgcaga gtcgggtaaa accgatgcag atccattgga tttactttgt      2160
     cacatagcat ttaacgtacc gctgcgaacc agaaaagagc gcgctgacta tttgaagaaa      2220
     aacaaaccgg acttttttga tcagtacggc ccagaggcac gcgcgatctt aacgtcttta      2280
     ctggacaaat acaccgacca cggccctaag caatttagta ttccggattc gctacaggta      2340
     ccgcccattt ctgaatatgg caatgtgatg gaaatagcca acctctttgg cggcgcattg      2400
     caaatgaaga ccgccgtgga ccaattacaa acgctgctct atagccagca ataa            2454
//

If you have problems or comments...

PBIL Back to PBIL home page