(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0267

BA000037.VV0267      Location/Qualifiers
FT   CDS_pept        278743..279885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0267"
FT                   /product="type I restriction-modification enzyme,
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93031"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93031"
FT                   /db_xref="GOA:Q7MPU5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU5"
FT                   /protein_id="BAC93031.1"
FT                   /translation="MKEYTLRDVLIRQKEAITVEDDAEYKRITIKMNGNGVLLRDEVIG
FT                   DAIGTKRQFLVSSDQFVLSKIDARNGAFGIVPKSCDGAIITGNFWAFDVNSELADVKYL
FT                   DFMSKTPEFKDFCIVASEGTTNRKYLDENKFLDKRILLPELAEQKKVVAKILKFKNKIE
FT                   LARKIRNEILSDLYVLLNSTFHKLIEGAVYKPMSKVAPLERRKVEIDVNAEYPELGVRC
FT                   FGNGTFHKPILNGMDVGTKKLYQMVPGDLVFSNVFAWEGAIAVVKKEDEGRVGSHRFIT
FT                   CLPKSGVVTADFLCFYFLTTEGLEKIQAASPGGAGRNRTLGLKKLENIEVPVPDYDKQL
FT                   WFNQLQSYVEKIKQAQSENATELEALMPSILDKAFKGELV"
     atgaaagagt atactttaag ggatgttctt atccgccaaa aagaggccat caccgttgag        60
     gatgatgctg agtataagcg cattaccatt aaaatgaatg gtaatggcgt gctccttaga       120
     gatgaagtca ttggtgacgc tataggaact aagcgccagt ttctggtgag ttctgatcag       180
     tttgtgcttt caaaaattga cgcaaggaat ggtgctttcg gaatagtgcc taaaagctgt       240
     gatggagcaa ttattacagg aaacttttgg gcatttgacg tcaactccga acttgcagat       300
     gttaaatacc tcgatttcat gtctaaaaca ccagagttca aagacttttg tatcgttgca       360
     agcgaaggta ctactaatcg aaagtacctt gacgaaaata agtttcttga taaacggatt       420
     ttgctacctg agctcgcaga gcagaaaaaa gtggttgcta agatcttaaa gtttaagaat       480
     aagatagagc tagcgcggaa aatccgaaac gagattttaa gtgatctcta cgtgctgtta       540
     aacagcacat ttcacaaatt aattgaaggc gctgtctaca agccgatgtc gaaagtggca       600
     cctcttgagc gccgtaaagt tgagatcgat gtgaacgcgg agtacccaga gcttggtgtg       660
     cgttgttttg gtaacggtac tttccacaag cctattctta acggaatgga cgttggtacc       720
     aaaaagctgt accaaatggt tcccggtgac ttggtgttca gtaatgtttt tgcttgggaa       780
     ggtgcgatcg cggttgttaa aaaagaagac gaaggtcgtg tcggttcgca tcgttttata       840
     acgtgtttac ctaaatcagg agtggtgaca gccgatttcc tttgctttta ttttctaacg       900
     actgaggggt tagagaaaat acaagcagca tcccctggag gtgctggaag gaatagaact       960
     ttaggactta agaagctaga aaatatcgag gttcctgtac ccgattacga taagcagctt      1020
     tggtttaatc aactgcaaag ctatgttgaa aaaattaaac aagctcaatc agaaaatgca      1080
     actgagttag aggctctgat gccttcaatt ttagataaag cctttaaggg agaattggtt      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page