(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0269

BA000037.VV0269      Location/Qualifiers
FT   CDS_pept        280679..283921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93033"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93033"
FT                   /db_xref="GOA:Q7MPU3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU3"
FT                   /protein_id="BAC93033.1"
FT                   /translation="MTLSQEHLLQVDQHWAVQSIGAERRDKAMEMAERRLVDVVLGNLL
FT                   EHAATEFDSDLLEQVATAYELAAIEGIGALLHPVANQDNKNIRELAQAGAFRAFGLYRV
FT                   LPVPSDNEARLFHVLHVSGLAYCADRWTDLRRWFEEQSSTVAVPSVAGVTWDKRLLYRI
FT                   FDCWLRLLRKNRWDDLDQISEIVLGLRNDQANYEKALLEQTQGAEAQSIAMRLVALYHW
FT                   AKATERLAVYMLQGEPVAIDAQLDQHFEAAQKAAQASKDPQLEMILRWLHVASRKMVAG
FT                   SLWWVAHTVNSRVTRFVSHVTKHKSLFELLPPQRAALQEQGLLDQASRAVIVDLPTSGG
FT                   KTALAQFRMLQALNQFDQDDGWVAYVAPTRALVSQITRRLREDFGPLGIQVEPLTGAIE
FT                   VDAFEEALLGEARAFQVLVATPEKLQLVMRNKKVARPLALVVMDEAHNIEDESRGLRIE
FT                   LLLATIKQESPRANFLLLMPFVPNANDLAQWLAADRGRSISLGTSAWQPNERIVGLFDI
FT                   HKGEKAGDWNLSFETLTTTQRTIHLKGTHKVDGNRPLQKLNYTKAKGVTTQAVAMAKVF
FT                   SKRGTSIAVAQTIPDTWSIARKVAAELEPLVQVHEDIKLVQRFLAAEISEDFELIDMLS
FT                   KGVVVHHAGLPAEALSLIEWLTEAGHIRVMCATTTIAQGLNFPVSSVFLATRKLPYGNE
FT                   MSHRAFWNLAGRAGRIGHDSVGVIGIAAGAQPNEIRKYVSDATASLVSRLEGMLDDLQT
FT                   AGKLADLSWVMQQEQWADFRSYIAHLWNEKRNLDAVIGEAEQLLRNTYGFGSLRAKADK
FT                   ASQEKADALLEATKGYVRKLAEHPENASLADVTGFSPEGVRSTLLDLNNLENKLTLADW
FT                   EPSSLFGDKSKSVLPSLMGIMLRVPQLQESLREISKGQGNSHRKLADITQAWVTGSSIE
FT                   SIAKTYFEGDSLTDQISKACRAVYRDLANNGAWGLSALSKMPTSGLDFEAMTDEEKRRL
FT                   NNLPAMLYHGVKTEEGVLMRMNSVPRSIAERAGEDFKARTEAGAEKTLSPRKASEYLKS
FT                   LKPDDWARLKPDNSSLSGEDYLKVWKRLSGEA"
     atgacgcttt cacaagagca cttactacag gtagatcagc attgggctgt tcagtcgatt        60
     ggcgctgagc ggcgtgataa agctatggaa atggcggaac ggcgcttggt tgatgtggtg       120
     ctgggtaatc tacttgaaca tgcggcaacg gagtttgaca gtgacttgtt agagcaagta       180
     gcaacggcgt atgagttggc cgcgatcgaa ggcattggcg ctttgttgca ccctgttgcc       240
     aatcaggaca ataaaaatat tcgtgagctt gcacaagctg gcgcgtttcg agcgttcggg       300
     ctttatcgtg tgttacccgt accgagtgac aatgaggcgc gcttgtttca tgtgttgcat       360
     gtgtcgggtt tggcgtattg cgccgatcgc tggaccgatt tacgtcgatg gtttgaagag       420
     cagagcagta cagtagcagt acccagtgtg gcaggtgtta cttgggataa gcgtttgctt       480
     taccgaattt ttgattgttg gttacgacta ctacgtaaaa accgctggga cgacttagat       540
     cagatttcag agattgtact tggtttacga aacgatcaag cgaactacga aaaagcgtta       600
     ctagaacaaa ctcaaggtgc agaggcgcaa agcatagcaa tgcgtttagt ggcgctttat       660
     cactgggcca aagcaacaga gcgtttagcg gtgtacatgc tgcaaggcga accggtagcg       720
     atagatgcgc aattagatca gcattttgaa gcggcgcaaa aagcggcaca agcctctaaa       780
     gacccgcagc tcgaaatgat tttacgctgg ttacacgtcg caagccgaaa aatggtcgct       840
     ggctctttat ggtgggtggc gcatacggtt aactcccgtg tgacacgctt tgtttcccat       900
     gtgactaagc acaagagctt atttgaactg ttaccgccgc aacgagctgc actgcaagag       960
     caaggtttac tcgaccaagc cagcagagcg gtaattgttg atttgcctac ctccggcggt      1020
     aaaaccgcgc tggcacagtt ccgcatgttg caagcgctga atcagtttga tcaggatgac      1080
     ggttgggtgg cctatgttgc gccaactcgc gctttggttt ctcaaattac tcgacgatta      1140
     cgtgaagatt ttggcccatt aggtattcaa gttgagccgt taactggcgc gattgaagtc      1200
     gatgcttttg aagaagcgct tttgggtgaa gcacgtgctt ttcaggtttt ggttgcaaca      1260
     cctgagaaac ttcagttggt gatgagaaac aaaaaagtcg ctcgcccatt ggccttagtt      1320
     gtgatggatg aagctcacaa tattgaagat gagtctcgtg gcttacgcat tgaacttctg      1380
     cttgcaacga taaagcaaga atcacctcgg gcaaacttct tactattgat gccatttgtg      1440
     ccgaatgcta acgatttagc tcaatggcta gccgctgatc gtggccgaag catcagcttg      1500
     ggcacctctg cttggcaacc gaatgagaga attgttggtc tatttgatat tcataaaggt      1560
     gaaaaagctg gtgattggaa tttaagtttt gaaactttga cgaccactca acgtacgatt      1620
     caccttaagg gaacacataa ggtggatggt aataggcctc tgcaaaagct caattataca      1680
     aaggctaagg gagtaacgac acaagctgtc gctatggcta aggtgttttc taaacgtgga      1740
     accagtattg cggttgcgca aactattcca gacacttgga gtattgctcg taaagttgcc      1800
     gcagaacttg aacctttggt tcaagtgcat gaggacatta agctggttca acgctttctt      1860
     gctgctgaga ttagtgagga ctttgagctc attgatatgc tgtcaaaagg tgttgttgtg      1920
     catcatgcag gcttacccgc tgaggcgctt tcattaatcg aatggcttac agaagctggc      1980
     catattcgag tgatgtgtgc aacgacaacc atagcacaag ggcttaactt ccctgtttca      2040
     tcagtgtttc ttgctacgag aaaattgcct tacggcaatg aaatgtcgca tcgggcattt      2100
     tggaacctcg cgggtcgagc tgggcgtatc ggccatgata gcgtcggcgt tatcggtatt      2160
     gcagcaggtg cacagccgaa tgagatccgg aaatatgtta gtgatgcaac cgcatcgtta      2220
     gtttcccgtt tggaagggat gctggatgat cttcaaactg cggggaaatt agcagactta      2280
     tcttgggtta tgcagcaaga acaatgggca gacttcagaa gctatatcgc tcatttatgg      2340
     aatgaaaaac gtaacttgga cgctgtaatt ggtgaagccg aacaattact gcgaaatacc      2400
     tacgggtttg gttctctgcg cgctaaagct gataaagcct cgcaagagaa agctgatgcg      2460
     cttcttgaag ctaccaaagg atatgtcaga aagttagctg agcatccaga aaatgcttct      2520
     cttgcagatg ttacaggctt ctctcctgag ggcgttcgtt caactttatt ggatttgaat      2580
     aaccttgaaa acaagttaac gcttgcagat tgggagcctt cgagtctatt tggcgataaa      2640
     tcgaagtctg tgctgccaag cttgatgggg attatgctgc gggttccgca gttacaagaa      2700
     agtttacgag agatcagtaa aggacagggg aatagtcatc gtaaacttgc tgatattacc      2760
     caggcttggg taacaggtag ctccattgaa tctatagcga agacttactt cgaaggtgat      2820
     agccttacag atcaaatatc taaagcttgc agagcggttt atagagattt ggccaataat      2880
     ggcgcttggg ggttgtcggc attaagcaaa atgccaactt caggccttga ttttgaagcc      2940
     atgacagacg aagaaaagcg cagattaaat aaccttccag cgatgcttta ccatggtgta      3000
     aaaaccgaag aaggcgtgtt gatgcgcatg aacagcgttc cgcgtagtat tgctgaacgt      3060
     gccggtgaag actttaaggc tcgaactgaa gccggtgcag aaaagactct gtcacctcga      3120
     aaagcaagcg aatatctgaa gtctttgaaa ccggatgatt gggcgcgttt gaaacctgat      3180
     aattcctcgc tgtccggcga agactatttg aaagtatgga aacggctttc aggtgaagct      3240
     taa                                                                    3243
//

If you have problems or comments...

PBIL Back to PBIL home page