(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0275

BA000037.VV0275      Location/Qualifiers
FT   CDS_pept        complement(287147..287317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93039"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT7"
FT                   /protein_id="BAC93039.1"
FT                   /translation="MKNHSIGSAYWPSSMANAAACRKGPSGETNKPPFAHLPWAVGTMG
FT                   QHLIHQALEGE"
     atgaagaatc actctattgg ttcagcgtat tggccttctt cgatggcaaa cgcagccgca        60
     tgccgaaaag gcccatcagg cgaaactaac aagcccccat ttgctcactt accgtgggca       120
     gttgggacaa tggggcaaca cttgatacac caagctttag agggagaata a                171
//

If you have problems or comments...

PBIL Back to PBIL home page