(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0276

BA000037.VV0276      Location/Qualifiers
FT   CDS_pept        complement(287229..287606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93040"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93040"
FT                   /db_xref="GOA:Q7MPT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT6"
FT                   /protein_id="BAC93040.1"
FT                   /translation="MSPLHNTTQEGANMQFMMRLAPITFPIAMLAGLGWCIGIALLEQP
FT                   HGIGYALTRHCLMVFVVLAPWLMLKLMFYVIVSLGRKLGLIPPARPTHSLGYEESLYWF
FT                   SVLAFFDGKRSRMPKRPIRRN"
     ttgagcccgc ttcacaacac cacacaggag ggcgctaaca tgcagtttat gatgcgactt        60
     gcccccatta cctttccaat agccatgctg gcaggccttg gttggtgtat tggcattgcc       120
     ttactcgaac aacctcatgg tataggctac gcacttactc ggcattgcct gatggtattc       180
     gtggtactcg ctccttggct gatgctaaag ctcatgttct acgtgattgt cagtttagga       240
     cgcaaactgg ggctcatccc gcctgcacgt ccaacgcaca gcctaggtta tgaagaatca       300
     ctctattggt tcagcgtatt ggccttcttc gatggcaaac gcagccgcat gccgaaaagg       360
     cccatcaggc gaaactaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page