(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0284

BA000037.VV0284      Location/Qualifiers
FT   CDS_pept        294941..296662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0284"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93048"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93048"
FT                   /db_xref="GOA:Q7MPS8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPS8"
FT                   /protein_id="BAC93048.1"
FT                   /translation="MRYLLKIKTIIWIATELVMKSRNKLLLLTLIPLVLLTAMVTAVFY
FT                   FNSVKSLDVELSEYRNELIETRKSELKAYLMMGVTAIKPLYDADVNGNNQQQAKQILKA
FT                   MRFESDGYFFAYDSKGVNTLHAIKPELEGKNLYGMKDDNGVAVIAGLIDASQKGDGFLY
FT                   FSWHKPTINAQAPKLGYAEYLPKWDWVLGTGIYIDDIDTQVAEHRVQSIASLNEHTLSA
FT                   IGFTLVGLLIACGVISVIVSRAILPLQHIAASLQDVAAGGGDLTARLSVESQDEVGEVA
FT                   KAFNQFMDKLHPLMVDIRSSAQTVQSAATGLDQQTSLASNQMQTHCLETDKVVTAVTEM
FT                   SATAREVANNTHATAQAIDSANAQISEAQVEVNHAIEGIGKLVDEVNITSDAISQLSQQ
FT                   TDQITKVLQVIGEIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTQNSTLE
FT                   IGDMLKQLQNGVARAVTTMSASQERGEQTALESVQIKESLAGIQSAVEMIRDMGIQTAS
FT                   AAEQQSAVAEDINQNLVTIQQIVNEINNNLQESETISTRLSVSGQEMHDLVGHFKL"
     ttgcgatacc tcttaaaaat taaaacaatc atatggatag cgacggaact tgttatgaag        60
     agtcggaaca aattattgct gctaacgtta atcccattag tgctgctgac agcgatggtg       120
     acagcggttt tctattttaa cagtgtaaaa agcttagacg ttgaactcag cgaatatcga       180
     aatgagctga ttgaaacgcg caaaagcgag ttaaaagcct atttgatgat gggcgtcacc       240
     gccattaaac cgctgtatga cgcggatgtg aatggcaaca atcaacaaca agccaaacag       300
     attttgaaag caatgcgctt tgaaagtgat ggttactttt ttgcttatga ttctaaaggc       360
     gtcaacacgc tgcacgcgat aaagccagag ttggaaggta aaaatcttta cggcatgaaa       420
     gatgacaatg gtgtcgcggt gatagcgggg ttgattgacg cttcacaaaa aggcgatggc       480
     tttctttatt tctcttggca caagccgacc atcaatgcgc aagcgcctaa attgggttat       540
     gcggaatatc taccaaaatg ggattgggta ctcggcacag ggatctacat tgacgatatc       600
     gacacgcaag tggcagagca tcgtgtacaa agtattgcca gtttgaatga gcatacctta       660
     tcggcgattg gattcacgtt ggtggggtta ttgattgcgt gtggtgtgat cagcgtgatt       720
     gtttctcggg cgattttgcc gctgcaacat atcgcggcct cattgcaaga tgtagcggca       780
     ggcggtggcg atttaaccgc tcgtttgagt gtcgaaagcc aagatgaagt gggggaagtg       840
     gccaaagcct tcaaccagtt tatggacaaa ttgcatcctt tgatggtcga tattcgcagc       900
     tcggcgcaaa cagtgcaaag cgctgccact gggctggatc aacaaacctc gttagccagt       960
     aaccaaatgc aaacgcactg tttggagacg gataaagtag tcaccgccgt gacggaaatg      1020
     agcgccacgg cgagagaagt cgccaacaat acccatgcca cggcgcaggc cattgattct      1080
     gccaatgcgc agatctcaga agcgcaagtc gaagtgaatc acgcgataga agggattggt      1140
     aaattggtcg acgaagtgaa catcacctca gacgccattt ctcagcttag ccaacagacc      1200
     gatcaaatca ccaaagtgtt gcaagtgata ggcgaaattg ctgagcaaac gaacttactg      1260
     gcactgaatg ccgccattga agcggcgcgt gcgggagagc aaggccgcgg atttgccgtg      1320
     gttgccgatg aagttcgttc attagcgagt cgcacacaaa acagcacgct ggaaattggc      1380
     gatatgctta agcagttgca aaacggggtg gccagagcgg tcaccaccat gtctgccagc      1440
     caagagcgtg gcgagcaaac ggcgcttgag tcagtgcaaa tcaaagaatc acttgctggc      1500
     atccagtcgg cggtggaaat gatccgtgat atgggcattc aaacggcatc cgccgctgaa      1560
     caacagagcg cggtcgctga ggacatcaat caaaacctgg tcaccattca gcaaatcgtt      1620
     aatgagatta ataacaactt acaagagtcg gaaaccatta gcacacgctt gagtgtgtct      1680
     ggccaagaaa tgcatgattt ggtcggtcac tttaagctct ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page