(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0285

BA000037.VV0285      Location/Qualifiers
FT   CDS_pept        296776..297450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0285"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93049"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93049"
FT                   /db_xref="GOA:Q7MPS7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS7"
FT                   /protein_id="BAC93049.1"
FT                   /translation="MSLKNLPSESMPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVIE
FT                   LADFLLRDFGSLRKLFSADEQSFCRHKGLGQAKYVQLQAVLEMTQRYLAETLQRGDALT
FT                   SPQHTKLYLSSMLRDRHREAFYVLFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRALH
FT                   YNAAALILAHNHPSGVAEPSQADRRITRRLSDALGLVDIRVLDHFVVGDGEVVSFAERG
FT                   WI"
     atgagcctaa aaaacctgcc tagtgaatcc atgccaagag aaaaattgct tcagcgaggg        60
     cctcaatctt tgtctgatgc cgagttgctt gcgatctttt tacgaacagg cacacaagga       120
     atgaacgtaa ttgaactcgc tgattttctg ttgcgagact ttggttcgct gagaaaactc       180
     ttttctgccg atgaacagag cttttgtcgt cacaaaggat tggggcaggc aaagtacgtt       240
     caattacaag ctgttttaga aatgacgcaa cgttatttgg ccgaaacact gcaacgtggt       300
     gatgcgctca ccagtcctca gcataccaag ctttatctct cttccatgct gcgcgatcgc       360
     catcgagaag cgttttatgt gttgttcctc gacaatcaaa atcgtgtcat taaagatgag       420
     gtgatgtttg aaggcaccat cgatgccgcc tcggtctatc ctcgggaagt cgttaaaaga       480
     gccttacact ataatgcggc cgctttaata ttggcgcaca accatccctc tggagtggca       540
     gagccaagcc aagcagaccg gcgaattact cgacgtttga gtgacgcatt gggcttagtg       600
     gatatacggg tattggacca ctttgtggtg ggcgatgggg aagtggtttc ctttgcggaa       660
     agaggctgga tttga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page