(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0286

BA000037.VV0286      Location/Qualifiers
FT   CDS_pept        297762..297998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0286"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93050"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93050"
FT                   /db_xref="GOA:Q7MPS6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS6"
FT                   /protein_id="BAC93050.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHARNATKRRFLPNLQTHRFWVESEKR
FT                   FVKLRLTAKGMRIIDKKGIDVVLADMRARGENV"
     atgtcccgag tatgccaagt aactggtaag cgtcctgcag ttggtaacaa ccgctcacac        60
     gcacgaaatg ctactaagcg tcgttttctg ccgaacctac aaactcatcg tttctgggta       120
     gagagcgaaa aacgttttgt taaactacgt ctgactgcta aaggcatgcg catcatcgat       180
     aagaaaggta tcgatgttgt tctagctgat atgcgtgcac gcggcgaaaa cgtttaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page