(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0296

BA000037.VV0296      Location/Qualifiers
FT   CDS_pept        305420..305878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0296"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93060"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93060"
FT                   /db_xref="GOA:Q7MPR6"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR6"
FT                   /protein_id="BAC93060.1"
FT                   /translation="MQIPKINVKYPSFIDGNDKAFLSMTQPNIGKPGNTGIKRIIKATG
FT                   YSIQGLKAAFKHEAAVRQEFALLVVAIVLATWLDVSMLERITLLAVVVLVLIVELMNSA
FT                   VEAVVDRIGVEHHELSGRAKDIGSAAVLVALIFAGFTWLYIVGSHYWW"
     atgcagatac ccaagataaa tgtaaaatac ccctctttca ttgatggcaa cgataaggca        60
     ttcctttcta tgactcagcc caacataggc aagccaggca acactggtat taagcgcata       120
     ataaaagcca caggctactc gattcagggc ttaaaagcag catttaaaca tgaggctgcg       180
     gttcgtcagg agtttgcttt gctcgtcgtt gcgattgtgc tagcgacttg gcttgatgta       240
     tcgatgcttg aacgtatcac gttgcttgcg gtggttgtgc tggtgctgat tgttgaatta       300
     atgaattcag cggtggaagc ggtggtggat cgcatcggcg tggagcatca cgaactcagt       360
     ggccgagcta aagacattgg ttctgcggcg gtgctggtgg cgttgatttt cgctggtttt       420
     acatggcttt atatcgttgg tagtcattat tggtggtaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page