(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0307

BA000037.VV0307      Location/Qualifiers
FT   CDS_pept        315923..316864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0307"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93071"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93071"
FT                   /db_xref="GOA:Q7MPQ5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ5"
FT                   /protein_id="BAC93071.1"
FT                   /translation="MKFRQDINGLRAIAVLGVITFHFFPNAMPGGFSGVDVFFVISGFL
FT                   MTGIIVESINKDNFSILRFYKSRFNRIAPALVVLCITLIILGWFILMPLDYKLLGKHIT
FT                   NSILFFSNVIYLRESGYFDVSSYDKWLLHTWSLSVEWQFYLLYPCVILLLRRFFDFNII
FT                   KKAILLMTLLGFIVSAYMSYTSPNSAYYLLVSRSWQMFIGGVVYLFPFYVGDKCQIRMH
FT                   ILGIILIVFSYFFISQHLPWPGVGSLLPVIGAALILFSNYQGGFISQCGIFRSIGSWSY
FT                   SIYIWHWPVVVFYITMIFKAIIFYSVYLALYY"
     gtgaaattta ggcaagacat taatggctta agggccattg cagttttagg ggtaattaca        60
     tttcattttt ttcccaatgc tatgcctggt gggttttccg gtgttgatgt tttttttgta       120
     atctctgggt ttttaatgac agggattatt gtggaatcta ttaataaaga taatttttca       180
     attttaagat tctacaaatc aagatttaat agaattgcac cagcgttagt tgtattgtgt       240
     atcactctaa tcatattagg ctggtttatt ttaatgccac tggattataa gttattaggt       300
     aagcatatta ctaatagcat tttatttttc tctaatgtga tttacttaag ggagtctgga       360
     tattttgatg tgtcttctta tgacaaatgg ttgttacata cttggtcttt gtcagtagaa       420
     tggcaatttt acttattata tccttgtgtt attctattat taaggcgttt ttttgatttt       480
     aacatcataa agaaagctat cttgctcatg acattattag gatttatagt tagtgcctat       540
     atgtcatata catctcctaa ttctgcatac tatctacttg tatctagatc atggcaaatg       600
     tttattggtg gtgttgttta tctatttcct ttttatgttg gtgataagtg ccaaataagg       660
     atgcacattc ttggtattat actgatagtg ttttcatatt tttttatttc tcaacattta       720
     ccgtggccag gagttggatc gttgcttcca gttatagggg ctgcgttaat attattttct       780
     aattatcagg gaggttttat ttctcaatgt ggtattttta ggtctattgg ttcttggtct       840
     tactcgatat atatttggca ttggcctgtt gttgtttttt atattactat gatcttcaag       900
     gctattattt tttattcggt ttatttggct ctatattatt ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page