(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0329

BA000037.VV0329      Location/Qualifiers
FT   CDS_pept        complement(339239..340036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0329"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93093"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93093"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN4"
FT                   /protein_id="BAC93093.1"
FT                   /translation="MKNGFSFVTLLSGIVASALTLSPSAVASSQESHIQQPTEVVLLNY
FT                   GLQLNYPQPVRLEQVLLDAQQQNRQQNGSPNAQALSFHEGFQLFNLDKQAEADAQLQHV
FT                   RQQLIELAKDEDYRQASQLLLTLLEKHQYGYRENINLDIDAVRLKADLNPALPGHYALK
FT                   QASRENKVLLLGLIDQKTVPFSADLDVADYIATSTLNNNGNKSEAWVIAPNGNSSKVGY
FT                   SYWNNQHMSVLPGSTIFIGFNSSNNELQALESDIVKLLGMIKG"
     atgaaaaatg gcttttcctt tgtcactctg ttgagtggaa ttgtggcgtc tgcattgact        60
     ctttcaccca gcgctgtagc tagttcacaa gagagccata ttcagcaacc cactgaagtg       120
     gtattgctca attacggttt acaactcaac tacccacaac cggttcgtct tgagcaagtg       180
     ctcttggatg cccagcagca aaatcgccaa caaaatggct cacctaatgc acaagcattg       240
     agttttcatg aaggcttcca gctgtttaac ctcgacaaac aagccgaggc ggacgcacag       300
     ctacagcacg ttcgccagca acttattgaa ctcgctaaag atgaagatta tcgccaggcc       360
     agccagcttt tactaacgct actggaaaag catcaatacg gttatcgcga aaatattaat       420
     ttggatattg atgcggttcg tttgaaagcg gatctcaacc ctgccctacc gggtcactat       480
     gccttgaaac aagcctcacg cgagaacaag gtgcttttat taggattgat tgaccaaaaa       540
     acagtgcctt tttctgcaga tctcgacgta gcagattaca ttgccactag cacattgaat       600
     aacaatggca ataaaagcga ggcatgggtg atcgcgccaa atggcaacag tagcaaagta       660
     ggttatagct actggaataa tcagcatatg tccgtgctac ctggctctac gattttcatt       720
     ggctttaact ccagtaataa tgagcttcag gcgctagaga gcgacatcgt caaactatta       780
     gggatgatca aaggttaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page