(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0332

BA000037.VV0332      Location/Qualifiers
FT   CDS_pept        complement(341032..341454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93096"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN1"
FT                   /protein_id="BAC93096.1"
FT                   /translation="MQRQRTKKLSAPPPRPQSSFQRMRGSIHPHTPEATFGNALTATDN
FT                   NESETSSNNEALKPSYSARYTMGLRVREDDKNKKRKSRAKLSGKEQKTQHTAATPSTVI
FT                   PAHAGIYSSTRARSRVWKCTHRSRQRRKRNQQQHRQ"
     gtgcagcggc aaagaacaaa aaaactcagc gcaccgccgc cacgccccca atcgtcattc        60
     cagcgcatgc ggggttccat tcatccacac acgccagaag ccacgtttgg aaatgcactc       120
     accgcaacag acaacaacga aagcgaaacc agcagcaaca atgaagcgct aaaaccgagc       180
     tacagcgctc gctatacgat gggtctccgc gttcgcgagg atgacaaaaa taagaaaaga       240
     aaaagcagag ctaagctcag cggcaaagaa caaaaaactc agcacactgc cgccacgccc       300
     tcaactgtca ttcccgcgca tgcggggatc tattcatcca cacgtgccag aagccgcgtt       360
     tggaaatgta ctcaccgcag cagacaacga cgaaagcgaa accaacagca acaccgacaa       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page