(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0338

BA000037.VV0338      Location/Qualifiers
FT   CDS_pept        345316..345687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93102"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93102"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM5"
FT                   /protein_id="BAC93102.1"
FT                   /translation="MRYKELEIWKRSYQVVLQVYNLLKTCRDYGLKDQISRSAVSVPSN
FT                   IAEGSERGSYKDNIRFLYIAKGSCAELATQISLAADLGYIPIEAGQKLESEILEIGRMI
FT                   GGYIKFLSQHVKEESAEYF"
     atgcgttata aagagcttga gatttggaag cgtagctatc aagtggtttt acaagtttac        60
     aacttgctca aaacttgccg agactatggc ttgaaagatc aaatctctcg ctctgctgtt       120
     tctgttccat caaacatcgc agaaggttcc gaaagaggta gttataaaga caatattcgt       180
     tttctttata tcgctaaagg ttcttgtgcg gagttagcga cacagatttc gctggcagcc       240
     gatttgggct atatcccgat agaagccgga caaaagctag agtcagaaat actagaaata       300
     ggtaggatga ttggcggtta catcaagttt ctttctcaac atgtgaaaga ggaaagtgct       360
     gaatatttct ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page