(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0343

BA000037.VV0343      Location/Qualifiers
FT   CDS_pept        351200..352519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93107"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93107"
FT                   /db_xref="GOA:Q7MPM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM0"
FT                   /protein_id="BAC93107.1"
FT                   /translation="MGQIYSTKKIRFSQSMSSLKSNITKGALWQSISIVSTFILIPISI
FT                   SYLGKEDYGLWIVLYSFILLLQSCDLGISSSCRNSLTKLLTQNNKVEAKYLLSTSYVIL
FT                   AGLSLGLLAFIYIIQKTVGIDALQAFPISIFAPILCVVLLDYNLKLVLTVYTSNHKAFV
FT                   LPLSTAMANVLFLMVVATLHFLDVGESNRLILFCFILPVCSLITNAFITLHAYNNGFKF
FT                   LKPSIFFFKKDYFQPLVLSGVSFFVIQVSMAILTQYASILVFEYSSSEVVADLSILDKF
FT                   FGMISVVGAVLLFPFWSKFTQKYTERDFDWIRKCILKLELFFIFTCFCVLILWYLFPFF
FT                   LDVWMTDNDEIAPSLSTIVAIKYLMIFLNSIYSYYLNGIGKLKIQIILYSLGATFIIPI
FT                   SSMLFQVFGVEGVVGYSVLIYFLLAISQKTYIVLSLKGER"
     ttgggtcaaa tctattcgac aaaaaaaata cgattttcgc agtcaatgtc tagcttaaaa        60
     agtaacataa cgaaaggggc tttatggcaa agtattagta tagtatctac gtttatatta       120
     attccaatat ccattagcta tttgggaaaa gaggattacg gactgtggat tgttctatat       180
     tcttttatat tgttattaca aagctgtgat ttaggaattt caagctcctg tagaaactct       240
     ctcacaaagc ttcttacaca gaataataaa gttgaagcta aatacttact ttcaacctct       300
     tatgttattt tggctggttt gtctttaggt ttattagctt ttatatatat tatacagaaa       360
     acagttggca ttgatgctct tcaagccttc cctatatcta tatttgcacc tatattgtgt       420
     gttgttcttt tagattacaa tctaaaacta gtgctgacag tttatacatc aaatcataag       480
     gcatttgttc ttccgctatc tacagcaatg gcaaatgtct tatttttgat ggttgtcgct       540
     actcttcatt ttcttgatgt tggtgaaagc aatcgtttaa ttttattttg ttttattctt       600
     cctgtgtgct cacttataac aaacgcattt ataacattac atgcttataa caatggattc       660
     aagttcctaa agccaagtat attttttttc aaaaaagatt attttcaacc gcttgtactt       720
     tcgggggtaa gtttttttgt aatccaagtt tcaatggcta tattaactca gtatgcaagt       780
     attctggtat ttgagtatag ctcaagtgaa gtggttgctg atctctcaat attggataag       840
     ttttttggaa tgataagtgt agtaggagct gttcttttat ttcctttttg gtccaagttc       900
     acacagaaat acacagaaag agatttcgat tggatcagaa agtgcatatt aaaactggaa       960
     ttatttttta tatttacttg cttttgtgtg cttatacttt ggtacctatt tccctttttt      1020
     cttgatgtat ggatgacgga taatgatgaa atagctccgt cattgagtac gatagtagcg      1080
     ataaagtatc ttatgatttt tctaaatagt atatattcat attatttgaa tgggattgga      1140
     aagttaaaaa tccaaattat attatattct ctaggggcga cttttataat tccaatatct      1200
     tccatgctat ttcaagtgtt tggtgttgaa ggtgtggttg gttactcagt tctaatatac      1260
     ttcctattgg ctatttctca aaaaacttat atagtacttt ctttaaaagg ggaaagataa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page