(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0344

BA000037.VV0344      Location/Qualifiers
FT   CDS_pept        352520..353737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93108"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93108"
FT                   /db_xref="GOA:Q7MPL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL9"
FT                   /protein_id="BAC93108.1"
FT                   /translation="MGGVCIAFLYFTNPFLFGRVFWGSDLITLALIFSSALFLLKNNAC
FT                   FSQKISPLKLSLLLSLSLYFITTTIIRLRVGQDFGDLSLHFYQYLSVLILLALRIDHRN
FT                   LEIFYKAICIALLWHVWTIIPQLPLNGFLSSKLSSQTAYAVGEYSIGGLSRRATGFFTA
FT                   PGYLSLFASSSLAIGVLLCISKVNKLNTSILILSCMAGFGSFSRTFMVIFILLVIYILI
FT                   VSRFKHKIFYGAILLLLGSYFTSTTIFKDYLGFVGERLAQSTDFSSNDRITGDTGVLIV
FT                   LEAIAQNPFTGSAIAPDGGDIKASVDGRIIRPHFGILAIISFYGVVVSLALVIPMLFAL
FT                   FKSFTTFTSNKDIEKPVTAAFLAAFLVCVAEPLIDTNLTVIFMAFSLLLSSEFYKNRSF
FT                   SSDFNH"
     atggggggtg tttgtattgc atttttgtat tttactaatc cattcttatt tggtagggtt        60
     ttttggggta gtgacttaat cactcttgcc ttaatatttt catcggcact tttcttgcta       120
     aagaataacg catgcttttc ccaaaaaata tcacctctaa agttatcttt gttattgtca       180
     cttagtttat acttcataac tactactata attagattga gggttggtca agattttgga       240
     gatttaagtc tacattttta tcaatatcta agtgttctga ttctacttgc gctaaggatt       300
     gaccatagaa accttgaaat tttttataag gctatatgta tagctctgct gtggcatgtt       360
     tggactatta ttcctcaact accgctgaat ggttttttat cgagcaagtt atcatcacaa       420
     acagcatatg cagttggtga atatagtata ggtgggctta gtagaagagc tacaggcttc       480
     tttactgctc ctggttactt gtccctattt gcttcttcct ctttagctat aggggttttg       540
     ttgtgcataa gcaaggttaa taaattaaac acttcaattt taattctatc atgtatggct       600
     ggctttggtt catttagccg aacatttatg gttatattta tactactagt tatttatata       660
     cttatagttt caaggtttaa acataagatt ttttacggtg ctatattact gttattagga       720
     agttatttta catctacaac tatttttaag gactatttgg ggtttgttgg cgagcgatta       780
     gcacaatcta cagacttttc cagtaatgat agaattactg gtgatacagg tgtattaatt       840
     gtgcttgaag caattgcaca gaatcctttt actggttcag caatcgcccc tgatggtggt       900
     gatattaagg ctagtgttga tggtagaata attagacctc actttggtat attagctatt       960
     atttcttttt atggcgttgt ggtctcttta gctttggtta tcccaatgtt atttgctttg      1020
     tttaagagtt ttacaacttt tacttctaat aaagatattg aaaaacctgt tacggcagca      1080
     tttttagcag catttttagt ctgtgttgca gagcctttaa tagacacaaa tttgaccgtt      1140
     atttttatgg cattttcatt attgctgtca tctgaattct acaaaaatag gagcttttca      1200
     agtgatttta atcactaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page