(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0345

BA000037.VV0345      Location/Qualifiers
FT   CDS_pept        353721..354437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93109"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93109"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL8"
FT                   /protein_id="BAC93109.1"
FT                   /translation="MILITNKVKTCDNLKDQRLSQAGLNYQAKLSEFLNPELELSLVPV
FT                   FLDYDYDNEEGSKHVFVNTIPRKGRFFRSLRYITDSFKLFFLACSSKEKSVLIYNLDIH
FT                   NLLFVFLNVYFSSKKNYIVVADYIVHKRHFTKVIFDFIYKKVDGVIVLNDRICINENTQ
FT                   LLAGLVRSGDVVQSKKFVSINDAIFSGSLGKTTGFELCLEAFSKLPDIRLNITGKPYHY
FT                   SENDFNFIISKFNSFE"
     gtgattttaa tcactaataa ggtaaaaaca tgtgataact taaaggatca aaggctttca        60
     caagctggat taaactatca agctaaatta agtgagtttt taaacccaga gttagagctt       120
     tcattagttc ctgtatttct tgattatgat tatgataatg aggaaggtag taaacatgtt       180
     tttgttaata ctattccaag gaaaggacgt ttttttagaa gtcttagata tattactgat       240
     agtttcaagt tgttcttttt agcttgttct tctaaagaaa agtcggtgtt gatatacaat       300
     ttagatattc ataacttgct gtttgttttt ctgaatgttt actttagtag taagaaaaac       360
     tatattgtcg ttgcagatta tattgttcat aaacgtcact tcactaaagt catctttgac       420
     tttatatata aaaaagtcga tggcgtaatt gttcttaatg atagaatttg cattaatgaa       480
     aatacacaat tacttgccgg cttagttagg tctggagatg tagttcaatc aaaaaaattc       540
     gtatcgatta atgatgcgat attttctggt tcccttggaa aaactacagg ctttgagctt       600
     tgcctagagg ctttttctaa attgcctgac attagactta atattacagg aaaaccatat       660
     cattattctg agaatgattt taattttatc attagtaaat ttaatagctt cgaataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page