(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0348

BA000037.VV0348      Location/Qualifiers
FT   CDS_pept        356341..357423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93112"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93112"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL5"
FT                   /protein_id="BAC93112.1"
FT                   /translation="MNKLLINFFSAKSGGGKVILDNFMEHFDADDVEIHFIFPSEYDFK
FT                   FEKHLEVKVPKWMNKPYGLFWFYFFFVPNYCRKNGISKVLNFGDVIFPRLKSQTYFFDW
FT                   AYLVLDDSNIWSSMDFKSRFIRMLKAALIKAFKSNNKTVIVQSEAISSSYKKILGFEGE
FT                   IVVAPTPVSINNIDGMSHGIDKNSLVYISNYAPHKNFEIIPRVASILKQNKVDCSIVLT
FT                   IDENSIHWRNLSCELSGLGVLDMVKTLGPLSQEDVFSVLKSSRALFFPSKLESYGIPLI
FT                   EAMILGKPVLTSDTPFIKSVCGDAVLYFDPKCPEDIATKITDFIDGVDYCRMRQSEVSK
FT                   VLENIPSWDQYTRLLIKSSI"
     atgaataagt tattaataaa cttttttagt gctaaatctg gtggcggtaa agtcatttta        60
     gataatttca tggagcattt tgatgctgat gatgtcgaga ttcactttat atttccatcc       120
     gaatatgatt ttaaatttga gaagcatctt gaagttaaag ttccgaagtg gatgaataaa       180
     ccgtatggtt tattttggtt ttattttttc tttgtgccta attactgtag aaaaaatggg       240
     atttctaaag ttcttaactt tggagatgta atctttccaa ggttgaaaag tcaaacttat       300
     ttttttgatt gggcatattt agttttagac gactcgaata tttggtcctc aatggacttt       360
     aagagtcgtt ttatccggat gttgaaagca gctttaatta aagcttttaa atccaataat       420
     aaaacagtca tagtacagag tgaagcaatt tcaagttcat ataagaagat cttaggcttt       480
     gaaggggaga ttgttgttgc cccgacacct gtaagcataa ataatatcga tgggatgtct       540
     catggtattg ataaaaactc tttggtgtat atttcgaatt atgctccaca taaaaatttc       600
     gaaataatac ctagagttgc ttcaatttta aaacaaaaca aagttgattg ttcaattgta       660
     cttactatag atgaaaactc tattcattgg agaaacttga gttgtgaatt gtcaggtttg       720
     ggggttttag atatggtgaa aacgttaggt cctttatctc aagaggatgt tttttcggta       780
     ttgaaaagtt caagagcatt atttttccca tcaaaacttg aatcatatgg tattcctctc       840
     attgaagcta tgattcttgg gaaacctgtc ttaacttctg atactccatt tattaagagt       900
     gtgtgtggtg atgctgtatt gtacttcgat cctaaatgcc ctgaagatat agcaacaaaa       960
     atcactgatt ttattgatgg ggtcgactac tgtagaatga gacaatctga agtttcaaag      1020
     gttttagaaa acatccctag ttgggatcaa tatacacgtt tgctaattaa aagtagcatt      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page